KEGG   Corynebacterium camporealensis: UL81_01170Help
Entry
UL81_01170        CDS       T03923                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ccj  Corynebacterium camporealensis
Pathway
ccj00020  Citrate cycle (TCA cycle)
ccj00190  Oxidative phosphorylation
ccj00650  Butanoate metabolism
ccj01100  Metabolic pathways
ccj01110  Biosynthesis of secondary metabolites
ccj01120  Microbial metabolism in diverse environments
ccj01130  Biosynthesis of antibiotics
ccj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UL81_01170
   00650 Butanoate metabolism
    UL81_01170
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    UL81_01170
Enzymes [BR:ccj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     UL81_01170
    1.3.5.4  fumarate reductase (quinol)
     UL81_01170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_7 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4 Fer4_18 Fer4_4 Fer4_15 Fer4_16 Fer4_2 Fer4_6 Fer4_21 Fer4_3 Fer4_22 Fer2 Fer4_13
Motif
Other DBs
NCBI-ProteinID: AKE38219
UniProt: A0A0F6T9L4
LinkDB All DBs
Position
229750..230499
Genome map
AA seq 249 aa AA seqDB search
MKLTLEIWRQAGPTQEGKFETIQVDDAAEQMSILELLDHVNDGLIEEGKEPFAFASDCRE
GICGTCGLLVNGRPHGPGQNTPACQQRLFQFNDGDTLKLEPFRSAAYPIIKDMVVDRAKL
DHVMEQGGYVSMDAGTAPDADTLHLNHETAEYSLDHAACIGCGACVASCPNGAAHLFTGA
KLVHLSLMPLGQEERGRRARSMVDDLEQNFGHCSLFGECADVCPAGIPLTAVSAVTRERA
RAAFRGKDD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgacacttgagatctggcgtcaggccggaccgacgcaagaaggcaagttcgaa
accatccaggtagacgacgctgcagagcagatgtccatcctggagctgctggaccacgtc
aacgacggcctgatcgaggaaggcaaggagcccttcgccttcgcatctgactgccgtgag
ggcatctgtggtacctgtggtctgctggttaacggccgtccgcacggcccgggccagaac
accccggcctgccagcagcgcctgttccagttcaatgatggtgacaccctgaagctggag
ccattccgctccgctgcataccccatcatcaaggacatggttgtggaccgcgccaagctg
gaccacgtcatggagcagggcggctacgtctccatggacgccggtaccgcaccggatgct
gacaccctgcacctgaaccacgagaccgctgagtactccctggaccacgccgcatgtatc
ggctgtggtgcttgtgtggcatcctgcccgaacggtgcagcccacctgttcaccggtgcg
aagctggttcacctgtcgctcatgccactgggccaggaagagcgcggtcgccgtgctcgt
tccatggtggatgacctggagcagaacttcggccactgctcgctgttcggcgagtgtgca
gatgtctgcccggctggcatcccgctgactgctgtgagtgctgttactcgtgagcgcgca
cgagctgctttccgcggcaaggacgactaa

DBGET integrated database retrieval system