KEGG   Corynebacterium camporealensis: UL81_02090Help
Entry
UL81_02090        CDS       T03923                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ccj  Corynebacterium camporealensis
Pathway
ccj00473  D-Alanine metabolism
ccj01100  Metabolic pathways
ccj01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ccj00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    UL81_02090 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    UL81_02090 (alr)
Enzymes [BR:ccj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     UL81_02090 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:ccj01011]
 Precursor biosynthesis
  Racemase
   UL81_02090 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AKE38399
UniProt: A0A0F6TAN2
LinkDB All DBs
Position
409768..410865
Genome map
AA seq 365 aa AA seqDB search
MLRTRIDLDAISHNVKVLKDMVGPQVNLMCVVKADAYGHGALKVAPIMAKAGADALGVAT
VEEAVALRRSGIDLPILGWMWDPNQDLTDALASNIDIGIPSLEHAQALVAAESPVRVYVK
VETGMHRSGVDEEQWRETFHLLADAPHITVLGLMSHFACADEPEHPLNDAQERTFRRAID
TARECGLDCPINHLANSPGALARPSSHFEQVRVGIACYGLDPVNSGADLRPAMTWASTVS
NVKPIQAGEAASYGLTWEAEHDGQLAVIAAGYADGVPRSAQDKLQVGIGGKLYPQVGRVC
MDQILVDLGENPYNVVAGDEAILFGEGGMSATELADALGTIDYEVLCLPGGRSRCVYEGG
VDLAG
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgaacaagaattgacctggatgcgatttcccacaacgtgaaagtcctcaaggac
atggtgggtccgcaggtcaacctgatgtgcgtggtcaaagctgatgcttatggccacggg
gcgctgaaagttgcgccgatcatggctaaagctggggcagatgccctcggcgtggccacc
gtagaagaagccgttgctttacgacgcagcggcatcgacctgcccattctgggctggatg
tgggatcccaaccaggatctcactgacgcgttggcgtccaacatcgacatcggcattcct
tccctcgagcacgcccaggccctcgtcgccgccgagtccccggtccgcgtctacgtcaag
gtcgaaactggcatgcaccgctccggcgtcgatgaagagcagtggcgcgagactttccac
ttgcttgccgatgccccacacatcaccgtgcttggtttaatgtcgcactttgcctgcgcc
gatgagccggagcatccgcttaacgatgcccaagagcgcaccttccgccgcgccatcgac
accgcccgcgagtgtggcctggactgcccgattaaccatctggccaattccccgggtgct
ttggcgcgtccttcctcccactttgaacaggtccgcgttggcattgcctgctacggcttg
gacccggtcaatagtggtgcggacctgcgcccggccatgacctgggcttcgacggttagc
aacgtcaagcccatccaggccggcgaagctgccagctacggcttgacctgggaagcagaa
cacgacggccaactcgccgtcattgccgccggttacgccgacggtgtcccccgcagtgcc
caggacaaactccaggtcggtatcggcggcaagctttacccgcaagttggtcgcgtctgc
atggaccaaattctggttgacctgggcgagaacccctacaacgtcgtcgccggcgacgaa
gccatcctattcggcgaaggcggaatgagcgctaccgaacttgccgatgcacttggcacc
atcgactacgaggtactctgcctgcccggcggtcgcagccgctgcgtctacgaaggaggc
gtcgaccttgcaggatag

DBGET integrated database retrieval system