KEGG   Corynebacterium camporealensis: UL81_06055Help
Entry
UL81_06055        CDS       T03923                                 

Definition
(GenBank) phosphoribosyl-ATP pyrophosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
ccj  Corynebacterium camporealensis
Pathway
ccj00340  Histidine metabolism
ccj01100  Metabolic pathways
ccj01110  Biosynthesis of secondary metabolites
ccj01230  Biosynthesis of amino acids
Module
ccj_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ccj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    UL81_06055
Enzymes [BR:ccj01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     UL81_06055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: AKE39175
UniProt: A0A0F6QWU7
LinkDB All DBs
Position
complement(1282136..1282417)
Genome map
AA seq 93 aa AA seqDB search
MEQLVPVKNFETLFAELSTKAKERPEGSGTVEALDAGAHHIGKKVIEEAGEVWMAAEYQS
DDELAEEMSQLIYWTQVMMIKRGLTPEDIYKYL
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
gtggaacaattggttcccgtgaagaatttcgagaccctttttgcagaactatccactaaa
gccaaagaacgccccgagggctctggcacggtagaagccctggatgccggggcccatcat
attggcaagaaggtcatcgaagaagccggtgaggtatggatggccgccgagtaccagtcc
gatgatgagctggctgaagaaatgtcgcagcttatctactggacccaggtcatgatgatc
aagcgggggctgaccccggaagacatttacaagtatctctag

DBGET integrated database retrieval system