KEGG   Corynebacterium crudilactis: ccrud_01980Help
Entry
ccrud_01980       CDS       T04829                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ccjz  Corynebacterium crudilactis
Pathway
ccjz00020  Citrate cycle (TCA cycle)
ccjz00190  Oxidative phosphorylation
ccjz00650  Butanoate metabolism
ccjz01100  Metabolic pathways
ccjz01110  Biosynthesis of secondary metabolites
ccjz01120  Microbial metabolism in diverse environments
ccjz01130  Biosynthesis of antibiotics
ccjz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccjz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ccrud_01980 (sdhA)
   00650 Butanoate metabolism
    ccrud_01980 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ccrud_01980 (sdhA)
Enzymes [BR:ccjz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ccrud_01980 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     ccrud_01980 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C NAD_binding_8 GIDA AlaDh_PNT_C Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ANE03097
UniProt: A0A172QQX2
LinkDB All DBs
Position
423774..425783
Genome map
AA seq 669 aa AA seqDB search
MSTHSETTRPEFIHPVSVLPEVSAGTVLDAAEPAGVPSKDMWEYQKDHMNLVSPLNRRKF
RVLVVGTGLSGGAAAAALGELGYDVKAFTYHDAPRRAHSIAAQGGVNSARGKKVDNDGAY
RHVKDTVKGGDYRCRESDCWRLAIESVRVIDHMNAIGAPFAREYGGALATRSFGGVQVSR
TYYTRGQTGQQLQLSTASALQRQIHLGSVEIFTHNEMVDVIVTERNGEKRCEGLIMRNLI
TGELTAHTGHAVILATGGYGNVYHMSTLAKNSNASSIMRAYEAGAFFASPSFIQFHPTGL
PVNSTWQSKTILMSESLRNDGRIWSPKKEGDDRDPNSIPDEERDYFLERRYPAFGNLVPR
DVASRAISQQINAGLGVGPLSNAAYLDFRDATERLGQDTIRERYSNLFTMYEEAIGEDPY
STPMRIAPTCHFTMGGLWTDFNEMTSIPGLFCAGEASWTYHGANRLGANSLLSASVDGWF
TLPFTIPNYLGPLLGVERLSEDAPEAVAAIDRAKARIDKLMNIRGDNPHGPDYYHRQLGD
ILYFSCGVARNVEDLQDGINKIRALREDFWKNMRITGTPDEMNQVLEYAARVADYIDLGE
LMCVDALDRDESCGAHFRDDHLSEDGEAERDDANWCFVSAWEPGANGTFVRHAEPLFFES
IPLQTRNYK
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgagcacacactctgaaacaacccgcccagagttcatccacccagtttccgtcctccca
gaggtttcggctggtacggtccttgacgctgctgaaccagcaggtgttccctctaaagat
atgtgggaataccaaaaagaccacatgaacttggtctccccactgaaccgtcgtaagttc
cgcgttctcgtcgttggtaccggtctatccggtggcgctgcagcagcagcactcggcgag
ctcggctacgacgtcaaggcgttcacctaccacgacgcacctcgccgtgcgcactccatt
gctgcacagggtggcgttaactccgcccgcggcaagaaggtagataacgacggcgcatac
cgccacgttaaggacaccgtcaagggtggcgactaccgctgccgcgagtccgactgctgg
cgtctagccatcgagtccgttcgcgtcatcgaccacatgaacgccatcggcgcaccattc
gctcgcgaatacggtggagctttggcaacccgttccttcggtggtgtacaggtctcccgt
acctactacacccgtggacaaaccggacagcagctacagctgtccaccgcatccgcacta
cagcgccagattcacttgggctccgtagaaatcttcacccacaacgaaatggttgacgtc
atcgtcaccgagcgtaacggtgaaaagcgctgcgaaggcctgatcatgcgtaacctgatt
accggcgaactgaccgcacacaccggacacgctgttatcttggcaaccggtggctacggc
aacgtgtaccacatgtcgaccctggcgaagaactccaacgcctcgtccatcatgcgtgca
tacgaagcaggcgcattcttcgcgtctccttccttcattcagttccacccaaccggcctg
cctgtgaactccacctggcagtccaagaccattctgatgtctgagtcgctccgtaacgac
ggccgcatctggtcaccaaagaaggaaggtgacgatcgcgatccaaacagcatccctgat
gaagagcgcgattacttcctcgagcgccgctacccagcattcggcaacctcgtcccacgt
gacgttgcttcccgtgcgatctctcagcagatcaacgctggtctcggtgtcggacctctg
agcaacgccgcatacctggacttccgtgacgccaccgagcgcctcggacaggacaccatc
cgcgagcgttactccaacctcttcaccatgtacgaagaggcaattggcgaggatccatac
tccaccccaatgcgtattgcaccgacctgccacttcaccatgggtggcctctggaccgac
ttcaacgaaatgacgtccatcccaggtctgttctgcgcaggtgaagcatcttggacctac
cacggtgcaaaccgtctgggcgctaactccctgctttccgcttccgtcgatggctggttc
accctgccattcaccatccctaactacctcggcccattgcttggtgttgagcgtctgtcc
gaggatgcaccagaagcagttgcagcgattgaccgcgcaaaggcacgcatcgacaagctg
atgaacatccgcggcgacaacccacacggacctgattactaccaccgccagctcggcgat
atcttgtacttctcctgtggcgttgcacgtaacgtagaagacctccaggacggcatcaac
aagatccgtgcactccgcgaggacttctggaagaacatgcgcatcaccggcaccccagat
gagatgaaccaggttctcgagtacgcagcacgcgttgctgactacatcgaccttggcgag
ctcatgtgcgttgatgctctcgaccgcgacgagtcctgtggcgctcacttccgtgacgac
cacctctccgaagacggcgaagcagaacgcgacgacgcaaactggtgcttcgtttccgca
tgggagccaggcgcaaacggaaccttcgtccgccacgcagaaccactgttcttcgagtcc
atcccactgcagacaaggaactacaagtaa

DBGET integrated database retrieval system