KEGG   Corynebacterium crudilactis: ccrud_01985Help
Entry
ccrud_01985       CDS       T04829                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ccjz  Corynebacterium crudilactis
Pathway
ccjz00020  Citrate cycle (TCA cycle)
ccjz00190  Oxidative phosphorylation
ccjz00650  Butanoate metabolism
ccjz01100  Metabolic pathways
ccjz01110  Biosynthesis of secondary metabolites
ccjz01120  Microbial metabolism in diverse environments
ccjz01130  Biosynthesis of antibiotics
ccjz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccjz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ccrud_01985
   00650 Butanoate metabolism
    ccrud_01985
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ccrud_01985
Enzymes [BR:ccjz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ccrud_01985
    1.3.5.4  fumarate reductase (quinol)
     ccrud_01985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_7 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4 Fer4_18 Fer4_16 Fer4_15 Fer4_4 Fer4_2 Fer4_6 Fer4_21 Fer4_3 Fer4_22 Fer4_13 Fer2
Motif
Other DBs
NCBI-ProteinID: ANE03098
UniProt: A0A172QQZ5
LinkDB All DBs
Position
425783..426532
Genome map
AA seq 249 aa AA seqDB search
MKLTLEIWRQAGPTAEGKFETVQVDDAVAQMSILELLDHVNNKFIEAGKEPFAFASDCRE
GICGTCGLLVNGRPHGADQNKPACAQRLVSYKEGDTLKIEPLRSAAYPVIKDMVVDRSAL
DRVMEQGGYVTINAGTAPDADTLHVNHETAELALDHAACIGCGACVAACPNGAAHLFTGA
KLVHLSLLPLGKEERGLRARKMVDEMETNFGHCSLYGECADVCPAGIPLTAVAAVTKERA
RAAFRGKDD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttacacttgagatctggcgtcaagcaggcccaactgcagaaggcaagttcgaa
accgtacaggttgacgacgccgtcgcgcagatgtccattctggaactgcttgaccacgta
aacaataagttcatcgaagcaggtaaagaaccattcgcattcgcgtctgactgccgcgaa
ggcatctgtggtacttgtggcctcctcgtgaacggccgccctcacggcgccgaccagaac
aagcctgcctgtgcgcagcgcctggtcagctacaaagaaggcgacaccctcaagatcgaa
ccactgcgttccgccgcatacccagtgatcaaggacatggtcgttgaccgttccgcactg
gaccgcgtcatggaacagggtggctacgtgaccatcaacgcaggtaccgcacctgacgct
gatacccttcacgtcaaccacgaaaccgctgaactcgcacttgaccacgcagcctgcatc
ggctgtggagcatgtgtcgctgcttgccctaacggcgcagcacacctgttcaccggcgca
aagcttgttcacctctccctactcccactgggcaaggaagagcgcggactgcgtgcacgt
aagatggttgatgaaatggaaaccaacttcggacactgctccctctacggcgagtgcgca
gacgtctgcccagcaggtatcccactgaccgctgttgcagctgtcactaaggaacgtgcg
cgtgcagctttccgaggcaaagacgactag

DBGET integrated database retrieval system