KEGG   Corynebacterium crudilactis: ccrud_02590Help
Entry
ccrud_02590       CDS       T04829                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ccjz  Corynebacterium crudilactis
Brite
Translation factors [BR:ccjz03012]
 Eukaryotic Type
  Elongation factors
   ccrud_02590
 Prokaryotic Type
   ccrud_02590
Mitochondrial biogenesis [BR:ccjz03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    ccrud_02590
Exosome [BR:ccjz04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ccrud_02590
  Exosomal proteins of breast cancer cells
   ccrud_02590
  Exosomal proteins of colorectal cancer cells
   ccrud_02590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ANE03204
UniProt: A0A172QR89
LinkDB All DBs
Position
549244..550434
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADAYPELNEAFAFDSIDKAPEEKE
RGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEEIIELVEMEVRELLAEQDYDEEAPIVHISALKAL
EGDEKWGKQILELMQACDDNVPDPIRETEKPFLMPIEDIFTITGRGTVVTGRVERGTLNV
NDDVDIIGIKEKSTSTTVTGIEMFRKLLDSAEAGDNCGLLLRGIKREDVERGQVIVKPGA
YTPHTEFEGSVYVLAKDEGGRHTPFFDNYRPQFYFRTTDVTGVVKLPEGTEMVMPGDNVD
MSVTLIQPVAMDEGLRFAIREGSRTVGAGRVTKIIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggcgaagttcgagcgtaccaagccccacgttaacatcggcaccatcggtcac
gttgaccatggtaagaccaccaccaccgcggctatcaccaaggttctggctgacgcttac
cctgagctcaacgaggctttcgccttcgactccatcgataaggctccagaggagaaggaa
cgtggcatcacgatcaacatctcccacgttgagtaccagaccgaaaagcgccactacgca
cacgttgacgctccaggccacgccgactacatcaagaacatgatcaccggcgctgctcag
atggacggcgcaatcctcgttgttgctgctaccgacggcccaatgccacagacccgtgag
cacgttcttcttgctcgccaggttggcgttccttacatcctcgttgctcttaacaagtgc
gacatggttgacgatgaggaaatcatcgagctcgtcgagatggaagttcgcgaacttctt
gctgagcaggactacgacgaagaggctccaattgttcacatctccgctctgaaggctctt
gagggcgacgagaagtggggcaagcagattcttgagctcatgcaggcttgtgacgacaac
gtcccagacccaatccgtgagaccgagaagccattcctcatgcctatcgaggatatcttc
accatcaccggtcgtggcaccgttgttaccggtcgtgttgagcgtggcaccctgaacgtt
aacgatgacgttgacatcatcggcatcaaggaaaagtccacctctaccaccgttaccggt
atcgagatgttccgtaagcttcttgactccgctgaagctggcgacaactgtggtctgctt
cttcgcggcatcaagcgcgaagacgttgagcgtggccaggttatcgttaagccaggcgct
tacacccctcacaccgagttcgagggctctgtctacgttcttgctaaggatgagggcggc
cgccacaccccattcttcgacaactaccgtcctcagttctacttccgcaccaccgacgtt
accggtgttgtgaagctgccagagggcaccgagatggttatgcctggcgataacgtcgac
atgtccgtcaccctgatccagcctgtcgctatggacgagggcctgcgtttcgctattcgc
gaaggctcccgcaccgttggcgctggccgtgtcaccaagatcatcaagtaa

DBGET integrated database retrieval system