KEGG   Corynebacterium crudilactis: ccrud_08225Help
Entry
ccrud_08225       CDS       T04829                                 

Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
ccjz  Corynebacterium crudilactis
Pathway
ccjz00010  Glycolysis / Gluconeogenesis
ccjz00520  Amino sugar and nucleotide sugar metabolism
ccjz01100  Metabolic pathways
ccjz01110  Biosynthesis of secondary metabolites
ccjz01120  Microbial metabolism in diverse environments
ccjz01130  Biosynthesis of antibiotics
ccjz01200  Carbon metabolism
Module
ccjz_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ccjz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ccrud_08225
   00520 Amino sugar and nucleotide sugar metabolism
    ccrud_08225
Enzymes [BR:ccjz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     ccrud_08225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ANE05343
UniProt: A0A172QXA1
LinkDB All DBs
Position
1746875..1747627
Genome map
AA seq 250 aa AA seqDB search
MTETGFGIDIGGSGIKGARVNLKTGEFIDERIKIATPKPATPEAVAEVVAKIISQAQWDG
PVGITLPSVVRGQIALTAANIDKSWIGTDVHELFDRHLEGREITVLNDADAAGIAEATFG
NPAARDGAVILLTLGTGIGSAFLVDGQLFPNTELGHMIIDGEEAEHLASAAVKENEDLSW
KKWAKRLNKVLREYEMLFSPSVFILGGGISRKHEKWLPLLELETEVVPAELRNRAGIVGA
AMAVNKHLAP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgactgagactggatttggaattgatatcggcggttctggcatcaaaggtgcccgagtt
aaccttaagaccggcgagtttattgatgaacgcatcaaaattgccaccccgaaaccagcc
actccagaagctgttgcagaagtagtcgccaagattatttctcaagcacaatgggatgga
cccgttggcatcaccctgccatcggtcgttcgcggacaaatcgcactgacagcagccaac
attgataaaagctggatcggcaccgatgtgcacgaacttttcgaccgacacctagaaggc
cgtgaaatcaccgtcctcaacgacgccgatgcagccggcattgccgaagccaccttcggc
aacccggcagcccgcgacggcgctgtcatcctcttaactttaggtaccggaatcggctcc
gcctttttagtcgacggccagcttttccccaacaccgaacttggccacatgatcatcgac
ggcgaagaagcagaacacctcgcatcagctgccgtgaaagaaaacgaagatctgtcctgg
aagaaatgggcaaagcgcctaaacaaagtcctacgcgaatacgagatgctcttctccccc
tccgtctttatccttggcggtggcatctccagaaaacacgaaaaatggctcccattacta
gagctagaaacagaagtcgtgccagctgaactaagaaatcgcgccgggattgtgggcgct
gcaatggcggtgaataaacaccttgcgccataa

DBGET integrated database retrieval system