KEGG   Corynebacterium crudilactis: ccrud_09535Help
Entry
ccrud_09535       CDS       T04829                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ccjz  Corynebacterium crudilactis
Brite
KEGG Orthology (KO) [BR:ccjz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccjz01001]
    ccrud_09535
Enzymes [BR:ccjz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     ccrud_09535
Protein kinases [BR:ccjz01001]
 Serine/threonine kinases: Other
  Bacterial family
   ccrud_09535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr Pkinase_fungal APH Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-ProteinID: ANE04417
UniProt: A0A172QUN6
LinkDB All DBs
Position
2042303..2044507
Genome map
AA seq 734 aa AA seqDB search
MANLKVGDVLEDRYRIETPIARGGMSTVYRCLDLRLGRSMALKVMDKDFVDDPIFRQRFR
REARSMAQLNHPNLVNVYDFSATDGLVYLVMELITGGTLRELLAERGPMPPHAALGVMRG
VLTGLSAAHRAGMVHRDIKPDNVLINSDHQVKLSDFGLVRAAHAGQSQDNQIVGTVAYLS
PEQVEGDEIGPASDVYSAGIVLFELLTGTTPFTGKDDLDHAYARLSEIVPAPSSLIDGIP
SLVDELVATATSINPADRFNDSAEFLAALEDVAKELELPHFRVPVPINSAANRANAQVPD
SQPTDMFTTHIPKTPEADHTAIIPAVGAGANETSILPAQHAAPLPETDYAPEPPPENSLH
FEDQELAQTDEPDIKPVSNRSPVKLALWSIFVVALIAAVAVGGWWFGSGRYGEIPQVLGM
DEVQAVATIERAGFGAVSQGQYDDEVPAGSIIGTDPSFGERLPRGDDIAVLVSQGRPVVP
DLSEDRSLSTVREELEQRTFVWVDGPGEYSDNVVEGDVVSLTPATGTALNVGETVQIHLS
RGPAPVEIPDVSGLDVNQATRVLEGAGLKVERTEEAFDAATPKGDVIGTSPAVSTEVKRG
TTLVLQVSNAISVPDVVGMTQEEAVSTLAEEGLIVASTSVIPGEAASSADTVVSIQPESG
GRVDPANPQVSLGLAGEIQVPSVVGRRVSDARSILEEAGLTLVTDADDSDRIFSQSPRAR
SDVSVGGEVTVRAF
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacttgaaggtcggtgacgttttagaagacaggtatcggattgaaactccgatt
gcccggggtggtatgtctaccgtgtacaggtgcttagatcttcgtttggggcgatctatg
gcgttaaaagtcatggataaagattttgttgatgatcctattttccggcagcgtttccgc
agggaagctcggtcaatggcgcagcttaatcacccaaatttagtcaatgtatatgatttt
tccgcgaccgatggacttgtctatctggtgatggaattaattaccggtggtaccttgcga
gagttattggcggagcgtggtcctatgcctccacatgcggctcttggagtgatgcgtggg
gtgctcacagggctctcagctgcacaccgagcggggatggttcaccgagatattaaaccg
gataatgtgttgatcaatagcgatcatcaagtgaaattatctgatttcggtttggttcga
gcagcccatgcaggacaatcgcaggataatcaaatcgtgggcactgtggcttatctgtct
cctgaacaagttgaaggcgatgagatcggccctgccagcgatgtctattccgcaggcatc
gtgctcttcgagctcctcactggcactactccttttacgggcaaggacgacctggaccat
gcttacgcccggctttcagaaatcgtgccggcaccgagctcgcttatcgatggcataccc
tccctcgttgatgaacttgtcgctactgcaacctctatcaatcctgcagatcgttttaat
gattcagcagaattcctcgcagcgctagaagatgtggcgaaagagctggagctcccacat
tttagagtcccagtacctattaattccgctgctaaccgcgctaatgctcaggtaccggat
tctcagccaacagatatgtttacaactcatattccaaaaactccagaagctgatcacact
gcaatcattcctgcagttggagcgggagctaatgaaacttcgattctgcctgcacaacat
gctgcgccgcttccagagacagattatgcaccagagccaccgccagaaaattcacttcat
tttgaagatcaagagctggcgcaaactgatgaacctgacatcaaaccagtgagtaatcgc
tcccctgtgaagctggctttgtggtcaatttttgtcgtggctctcatcgctgctgttgcc
gttggtggttggtggtttggctcaggccgatatggggaaatcccccaagttctgggcatg
gacgaagtacaagctgttgcaaccatcgaaagagcaggatttggggcggtttctcaaggt
cagtatgacgatgaggtaccggctggttccatcattggaactgatccatcttttggtgag
cgccttcctcgcggcgatgacattgctgtcctcgtctctcaagggcgtcccgtggtgccg
gatcttagcgaggatcgatccttaagcaccgttcgcgaagagttggaacaacgcactttt
gtgtgggtggatggcccaggggaatattcagacaatgttgtggaaggtgacgtcgtatct
ttgacaccggccaccggcactgcattaaatgtcggtgaaactgtgcaaatccacttgagt
aggggtcctgcccctgtagagattccagatgtttcaggtctcgatgtcaaccaggccacc
agagttttggagggtgctgggttaaaggtggagcgcaccgaagaagcatttgatgcagca
acccccaaaggtgatgtcattgggacttcaccggcagtatccacagaggtaaaacgtgga
acaacacttgtgttgcaggtctccaatgcaatttcagtaccagatgttgtgggtatgacc
caagaagaagcagtctctacacttgccgaagaaggcttgatcgtggcgtcgacaagcgtt
attcccggtgaggccgcaagctctgctgataccgtcgtttctatccaacctgaatccggt
ggccgcgttgatccggctaatccacaggtcagcctggggctggctggtgaaattcaggtt
cctagcgtggttggccgtagagtaagcgatgctcgcagcatcttggaagaggccggtttg
acgctggtcaccgatgctgatgatagcgatcgtatttttagtcaatctccgcgcgcacgc
agtgatgtttcagttggcggagaagttacagttagggcattttag

DBGET integrated database retrieval system