KEGG   Corynebacterium crudilactis: ccrud_12425Help
Entry
ccrud_12425       CDS       T04829                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K14949  serine/threonine-protein kinase PknG [EC:2.7.11.1]
Organism
ccjz  Corynebacterium crudilactis
Brite
KEGG Orthology (KO) [BR:ccjz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccjz01001]
    ccrud_12425
Enzymes [BR:ccjz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     ccrud_12425
Protein kinases [BR:ccjz01001]
 Serine/threonine kinases: Other
  Bacterial family
   ccrud_12425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PknG_TPR Pkinase Pkinase_Tyr TPR_19 NPF
Motif
Other DBs
NCBI-ProteinID: ANE04922
UniProt: A0A172QW41
LinkDB All DBs
Position
2687559..2690054
Genome map
AA seq 831 aa AA seqDB search
MTNDNNFEDLHPESPATEAVAFNPFDDDDDEEDDNQGSPATSAVAFNPFDDDDEDEDDFH
GDGLEYLLRDLDNLRATQGQMVVEQPVVEDSVGSESANTETTAATLRPRQEVDPSERSRR
QAISLFRERRRIRRQSRVVADGMVELPFITPTPEDELLIDPEKKRKPGVHLPQLEAGDIV
AEQYEVLGVIAHGGMGWIYLANDRNVSGRIVVLKGMMGQTSIQDQGTAEAEREFLADITH
PGIVKAYNFIDDPRVPGGFIVMEYVNGPSLRDRCKAQPDGVLRVDLAIGYILELLPAMDY
LHQRGVVYNDLKPENVIATEDQVKLIDLGAVTGMGAFGYIYGTKGFQAPEVSTEGPSIAS
DIFTIGRTLAALTLQLPVEDGIFAPGIPSPKNSPLLRRHLSFYRLLQCATAEDPKQRFRN
VGELRTQLYGVLREILAVRDGKQFPHQHSLFSPQRSTFGTKHLVFRTDRIIDGIDRQARI
TAPEIVSALPVPLIDRTDPGARMLSGSSYAEPSETLETLRTAMEDEKYRESIEIPLGVVR
ALLDLGFTTEARQWLETLEERIGDDWRHQWFSGITYLLLDDYATAQIFFNTVLTILPGEA
APKLALAAVDELILQHMGLDATAFLTPEIVAATATLSQDFEELDASAFEALSDTWSHISS
DPQVVRFHSLRLYALVWATNPTTVSSAFGLARQLMAENQVELAVQALDKLSQSSTHYRMA
NLTTILLLVSSNLSESRIRRAARRLSEIPTNEPRFNQIKIAIMSAGLSWLRESNLKASAS
ANPLFEFPFSQRGLRTGISEALRIQARSAPFPHHRYALVDMANAVRPLSWF
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacgataacaacttcgaagatctccatccagaatcccctgcaacagaagcagtg
gcatttaatcccttcgatgacgacgatgatgaagaagacgataatcaaggttcacctgcg
acctctgctgtagccttcaatcctttcgatgacgatgacgaagacgaagatgatttccac
ggcgatggactggaatatctgctgcgtgacctcgataatctacgtgccacccaaggccag
atggtggtggaacagcctgtcgtagaagacagtgtcggttcggaatcagcaaatacagaa
actactgcggcaacactgcggccccgccaagaggtggacccaagtgagaggagtcgtcga
caagcaatctccctgttccgtgaacggcgccgaattcggcgccaatctcgcgtggttgct
gatggcatggtcgaactgcctttcatcacgccgacccccgaagatgagctgctcatcgac
ccagagaaaaagcggaaacctggcgtacatctcccccagctagaagccggcgatatcgtt
gccgaacaatatgaagtactcggtgtcatcgcacacggcggcatgggttggatttatctc
gccaatgaccgcaatgtgtccggccgcatcgtggtgctcaaaggcatgatggggcaaact
tcgatccaagatcaaggcaccgccgaagccgaacgcgaattcctcgcagatatcacgcac
ccaggcatcgtgaaagcctataactttatcgacgatccgcgtgttcctggcggcttcatc
gtgatggaatacgtcaatggcccctccctgcgcgatcgctgcaaagcacaacccgatgga
gtgctccgagtagatctagccattggctatattttggaattactcccagccatggactac
ctgcaccaacgcggtgtggtttataacgacctcaaaccagaaaacgttatcgccaccgaa
gaccaagtaaaactcattgacctcggcgcagtcaccggtatgggagcctttggctatatt
tacggcacaaaaggcttccaagcacccgaagtatccaccgaaggcccctccatagcctcc
gatattttcaccatcggccgcaccctggctgcattaactctgcagctccccgtagaagac
ggcatcttcgcaccgggtatcccctccccgaagaattctccgctgctgcgcagacaccta
tcgttttatcgtttgctacagtgtgcaaccgcggaggatccaaaacaaagatttagaaat
gtcggcgaactacgcacccagctttatggtgtgctccgcgagattctggctgtgcgcgat
ggtaaacaattcccgcaccagcattctctgttttctcctcagcgaagcacttttggcacc
aaacacctggtgtttcgcacagaccgcatcatcgatggcatcgaccgccaagcacgtatc
acggcacctgaaattgtttctgcgctgccagttccgctcatcgatcgcaccgaccccggt
gcacgtatgctttctggttcctcctatgcagaaccttcagaaaccttggaaaccctgcgc
actgccatggaagatgagaaataccgcgagtccattgaaattcccctcggtgttgttcgt
gccctcctagatcttggtttcaccaccgaagcgcgccaatggttagagaccttggaagaa
cgcatcggcgatgattggcgccaccagtggttctctggaattacatatttactactcgat
gactacgcaacagcccagatatttttcaacactgtactcaccatcttgcctggtgaagct
gccccaaagcttgctttagcagctgtcgatgagctaattttgcagcacatgggactagat
gcaactgcatttctcactcccgaaatcgtcgcagccactgccactctgagccaagatttc
gaagagttagacgcctctgctttcgaagctctcagcgatacgtggtcacatatttccagt
gatccccaggtagtacgtttccactcgctacgcctctacgcactggtgtgggcaacaaac
cccaccactgtgtcctctgcttttgggttagcacgccaactgatggccgaaaaccaagtg
gaacttgccgtgcaggctttagacaaattatcacagtcctccacgcactatcgcatggca
aatttgaccactatcttattgttggttagctccaatttgagtgaatcacggatccgcaga
gctgctcgtcgcctctctgaaattcccactaatgaaccgcggttcaaccaaatcaaaatt
gccattatgtccgctggtctcagttggcttcgagaaagcaaccttaaagcttctgcctct
gccaacccactctttgagtttcctttttcccagcgtggtctacgcactggcatctctgaa
gctctacgcattcaggcacgttctgcaccatttccacaccaccgttatgcactggtggat
atggcaaatgccgtccgtccgctgagctggttctag

DBGET integrated database retrieval system