KEGG   Clostridium carboxidivorans: Ccar_00290
Entry
Ccar_00290        CDS       T03979                                 

Definition
(GenBank) histidinol-phosphate aminotransferase
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
cck  Clostridium carboxidivorans
Pathway
cck00340  Histidine metabolism
cck00350  Tyrosine metabolism
cck00360  Phenylalanine metabolism
cck00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cck00401  Novobiocin biosynthesis
cck01100  Metabolic pathways
cck01110  Biosynthesis of secondary metabolites
cck01230  Biosynthesis of amino acids
Module
cck_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cck00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Ccar_00290
   00350 Tyrosine metabolism
    Ccar_00290
   00360 Phenylalanine metabolism
    Ccar_00290
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ccar_00290
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Ccar_00290
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cck01007]
    Ccar_00290
Enzymes [BR:cck01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     Ccar_00290
Amino acid related enzymes [BR:cck01007]
 Aminotransferase (transaminase)
  Class II
   Ccar_00290
SSDB
Motif
Pfam: Aminotran_1_2 DUF5854
Other DBs
NCBI-ProteinID: AKN29355
LinkDB
Position
52186..53250
AA seq 354 aa
MSKYWSEITKSIEPYVCGEQPKDKKYIKLNTNESPYPPSPKVLEAIKNAANGELRLYPDP
DCDEFRKAIAEYYNLSKDEIFIGNGSDEVLAFSFLTFFNTNETIIFPDISYSFYPVYAGL
YNLNYRLAKLEDDFSIPVSEFAEKNGGVIIPNPNAPTGRCLDTDSIKRILNYNSNKVVII
DEAYIDFGGNSVVGLIKEYDNLLVIQTLSKSRSLAGIRVGFAMGNKELIQGLNRVKNSFN
SYTIDRVAAAAAVAAIKDKEYFTQCVTKVINTRERIIKKLNSLGFNVVPSKANFIFITHK
DYAASDLFAKLREKSVLVRYFSKERINNYLRVSIGSDEEMNFFIEKLQEIMDEI
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgagcaagtattggagtgaaattacgaaaagtatagaaccttatgtttgcggagagcag
cctaaggataaaaaatacataaaattgaacacaaatgagagtccatatcctccatcacct
aaagtgttagaagcaataaaaaatgcagctaatggagaattgagattgtatccagatcct
gattgtgatgaatttagaaaagctattgcagaatattataatttaagcaaagatgaaatc
tttataggtaatggatctgatgaagttttagctttttcatttttaactttttttaacact
aatgagactattatctttcctgatataagttacagcttttatcctgtttatgctgggtta
tataatttaaattataggcttgcaaaattagaagatgatttctctataccagttagtgag
tttgcagaaaaaaatggaggagtaattattccaaatcctaatgcacctacaggaaggtgt
cttgatacagattctataaagagaattttaaattacaattctaataaagtagttataatt
gatgaagcttatatagattttggtggaaattcagtagttggacttataaaagagtacgat
aatctcttggtaatacaaacactttctaaatcaaggtcactagcaggaattcgtgtaggt
tttgccatgggtaataaagaacttatacaagggttaaatagagtaaaaaattcttttaac
tcttataccatagatagggtggcagcagcagcagcagtggcagcaataaaggacaaagag
tattttacacagtgcgtaacaaaggtaataaacacaagagaaagaattataaaaaaatta
aattctttaggatttaatgtggtaccttcaaaggctaattttatttttataacacataag
gattatgctgctagtgatttgtttgctaagttaagagaaaaaagtgtgctggtaagatat
tttagtaaagagagaataaacaattatttaagagtaagtatagggtcagatgaggaaatg
aacttcttcattgaaaagttgcaggaaattatggatgagatttaa

DBGET integrated database retrieval system