KEGG   Clostridium carboxidivorans: Ccar_00315
Entry
Ccar_00315        CDS       T03979                                 

Definition
(GenBank) hypothetical protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_00315
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_00315
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_00315
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_00315
SSDB
Motif
Pfam: dCache_1 MCPsignal HAMP dCache_2 HAMP_2 DUF3974 DUF1664 TnpV Secretogranin_V T7SS_ESX_EspC
Other DBs
NCBI-ProteinID: AKN29360
LinkDB
Position
55952..57955
AA seq 667 aa
MKGKMKLHTQIIAILIFMAIIPQCIIAFFNYYYVKKNFNNMFNDYLYTTLGKIDETIKSV
DQSSKESVDMISKNTNNQNVLKDTNAANSILDFNNVYAQSHKEVSAAYLGASDGRMLVQP
KQNLPEGYDPRKRPWYPQAVSKNGEIFLTDPYEDAFNKGQYVVSYVKSVKDNTSGQVIGV
AGIDIKLTQIAQQVANSKIGDSGYAAVVDGTGTIIAHKDSSLIGKNSKDQKWINDVVNSG
KTGVFEKINGTNYFVYSLKNAETGWKILGFIPETEFNSKINSILKMIVIIGLIVIILAVV
IGNLFSKSITKPVENIERSLIKLSKGDFTEKIDEDVKCSTEIHSITKSLNLMIGEVVEII
RETIESSKRIKESTEAMVNICKQSTGAGEEIAKSIQGIANGASNQAQNVEDSSKLAELLG
EKVKGCLEDSKHMLEASSRVKVSTEKGLENINKLVVSFDKTAKSNEEVLEEVNVLAENSK
KVNEITETIKQITEQTNLLALNASIEAARAGEAGKGFAVVAEEVRELAEQSGQSAEEINA
IVNKIGSSVKAVLNKINYSTEIGIETGKSVHQTNSSFEDIESDSKILRSSIEKVSSELEG
VGKDRENIVEAFLGLARIAEDTAASTEEVSASSQEQASGLSEVLASAEKLSNLTDELNAA
VKNFKIN
NT seq 2004 nt   +upstreamnt  +downstreamnt
atgaaaggaaaaatgaagcttcacacgcaaattatagcaatattaatttttatggcaata
atacctcaatgtattatagctttttttaattattattacgtaaagaaaaattttaacaat
atgtttaatgattatttatacactactcttggaaaaatagatgaaacaattaagtctgtg
gatcaaagcagcaaggagtcagttgacatgatatctaagaatactaataatcaaaatgtt
cttaaagatactaatgctgccaactcaattcttgattttaacaatgtttatgcgcaaagt
cataaggaagtaagtgcagcctatttaggtgcaagtgatggaagaatgctcgtacagcct
aagcagaatttgccagagggttatgatccacgaaagagaccatggtatccacaagcagta
tccaaaaatggagaaatatttcttacagatccttatgaagatgcctttaataaaggacaa
tatgtagtcagctatgtaaagtcagttaaggacaatactagtggacaagttataggagta
gctggaatagatataaagcttactcaaattgctcaacaagtggctaattcaaaaataggt
gattcaggttacgcagcagtagttgatggaacaggaacaataatagcacataaggattct
tctcttattggaaaaaattctaaagatcaaaagtggataaacgatgttgttaattcagga
aaaacaggagtatttgaaaaaataaatggtacaaattattttgtatatagtttgaaaaat
gctgaaactggctggaaaatacttggctttatacctgaaacagagtttaattctaaaata
aatagtattctaaaaatgatagttattataggattaatagttatcattttagcagtagta
attggaaacttattttctaaatctattactaagcctgtagagaatattgaaagaagttta
attaagcttagtaagggagatttcacagaaaaaatagatgaagatgtaaagtgtagtaca
gaaatacattctataacaaaatctttgaatttaatgataggtgaggtagtagaaataatt
agagaaaccatagaaagttctaaacgtataaaagaatctacagaagctatggttaatata
tgcaaacaatctactggtgcaggagaagagatagctaaatcaatacaaggtattgctaat
ggagcttcaaatcaagcacaaaatgtggaagatagctctaaactggctgaacttttagga
gaaaaagtaaaaggatgtttggaggattcaaaacatatgctagaagcttctagtagagtt
aaagtttctacagaaaagggtttagaaaatataaataagttggtggttagttttgataaa
acagctaaatccaatgaagaagttttagaagaagtaaacgtgcttgctgaaaattctaaa
aaggttaatgagataacggaaactataaaacaaataacagaacaaactaatttacttgca
ctaaatgctagtatagaagcagctagagctggtgaggctggaaaaggttttgcagtagta
gcagaagaagtaagagaattagcagagcaatcaggacaatcagcagaagaaattaatgct
atagtaaataaaattggaagcagtgtaaaagctgttttaaataaaattaattattctacg
gaaataggcatagaaacaggaaagagtgtacatcaaactaattcatcctttgaggatatt
gagagtgattcaaaaatacttagaagcagcatagaaaaagtaagcagtgaattagaaggt
gttggtaaagatagagaaaatatagtagaagcatttttaggtttagctcgaattgctgaa
gacacggcagcatctacagaagaagttagtgcatcatcacaagagcaagctagtggactt
agtgaagttctagcatcagcagaaaaattaagcaatttaacagacgaactgaatgctgca
gttaaaaactttaaaattaattaa

KEGG   Clostridium carboxidivorans: Ccar_01395
Entry
Ccar_01395        CDS       T03979                                 

Definition
(GenBank) hypothetical protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_01395
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_01395
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_01395
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_01395
SSDB
Motif
Pfam: MCPsignal dCache_1 Cache_3-Cache_2 HAMP dCache_2 sCache_3_2
Other DBs
NCBI-ProteinID: AKN29569
LinkDB
Position
complement(284588..286609)
AA seq 673 aa
MTIQKKLPLFLAILVTISLIVTSLFVYFFTSKMLKNEALNKVTINCNLGTDDINSLIVSE
KKEVELLSQQKDIVDISKSRKSNSDDSFFSTYINHKSFTILKNRASTLKNHEHLFVIDLN
GEIFADSNTSSLKLDLKSRKYFQDALKDKASISDTIISKANGKSIIVFVYPVKDDFGNVI
AVMADSVYTDYFTDKLKNIKIGNTGYAYLVDKSGLVLSHPLKEKINKKIENSKILQVVSR
INKGETIKLDTGCYNINGITELMSYNLVPEVDWVFAVTQNATEANSAANLLLKIILAATA
VSAMISIFLGYVVSKKITLPINELMGLMDKAANGDITVISHFHSKDELGNLSANFNKMIS
NIKSLIIDIDEAILIVINGAELLTKVSKENVESISQVSFEIENIAKGANHQAKETDYTYT
LFEKFGKLIDTASIMNLKINEYSSSIKESNNNGKAIVKDLQEKNNAQSKLSNNLTYAIEN
LDKKSLNIKDITNTISDIAEQTNLLSLNAAIEAAKSGKQGNGFAVVADEIKKLASQSKSA
AEEISFIIGEIQNQMHYSVNTAKSVELAIDKQTIAVSNTEKAFDTISEKICNIASKIDES
SKLFSELKNNKNVMLNSVQNISSICEKTAASSEEVSASTEQQTASMESISVESENLKNQI
IKLKETSKLFKIR
NT seq 2022 nt   +upstreamnt  +downstreamnt
atgactatacaaaaaaaattaccattgtttttagctatactagtaacaatttctttaatt
gttaccagtctatttgtttattttttcacttcaaaaatgctaaaaaatgaagctctaaac
aaagttacaattaattgtaacttaggcactgacgatatcaattcacttatagtttctgag
aaaaaagaagttgaactattatcacagcaaaaggatatagtagatatatccaaaagtaga
aaatcaaattcagacgattcttttttttctacttatataaatcataagtcattcacaatt
ttaaaaaatagggctagcacattaaaaaatcatgaacatttatttgtaatagatttaaat
ggtgaaatatttgctgacagtaatacctcatcattaaaattagatttaaaaagcagaaaa
tattttcaagatgcactaaaagacaaagcatctataagcgatactataatatctaaagct
aatggaaaaagtattatagtttttgtttatcctgttaaagatgattttggaaacgttatc
gccgttatggcagactcagtatatacagattatttcacagataaactcaaaaatataaaa
ataggcaatacaggatatgcatatttagtagataaatctggattagtgttatctcatcca
ctaaaagaaaaaataaataaaaaaatagaaaattctaaaattctacaagttgtatcaaga
attaataaaggtgaaacaattaaattagatactggatgctataatatcaatggtataaca
gaacttatgtcttataatttggttccagaagtagattgggtatttgcagtaacgcaaaat
gccactgaagcaaattcagcagcaaatctattacttaaaattatattagctgccactgct
gtatccgcaatgatatctatttttttaggctatgttgtttcaaaaaaaattactttgcct
ataaatgaattaatgggtttaatggataaagcagcaaatggtgatataactgtaatttca
cattttcactctaaagatgaattaggaaatttgagtgctaattttaataaaatgataagt
aatataaaatcactaattatagatattgatgaagcaattttaattgtaataaatggtgcg
gaactattaactaaagtttcaaaagaaaatgttgaatccatttctcaagtatcctttgaa
atagaaaacatagcaaaaggagctaaccatcaagcaaaagagactgattatacttacact
ttatttgaaaaatttggaaaattaattgacactgcttcaataatgaatttaaaaataaat
gaatattcttcctcgataaaagaatccaataataatggtaaagctattgtcaaagattta
caagaaaaaaataatgctcaaagcaagcttagtaataacttaacttacgcaattgaaaac
ttagataaaaaatctttaaatattaaagatataacaaatactatctctgatatagcagaa
caaacaaatttgctttcacttaatgcagcaatcgaagctgctaaatctggtaaacaagga
aatgggtttgcagttgttgcagatgaaataaaaaaattagcaagtcaatcaaaaagtgca
gctgaagaaatatcatttataattggagaaatacaaaaccagatgcattattccgtaaat
acagctaaaagtgtagaacttgctattgataaacaaacaattgctgtatcaaatactgaa
aaagcctttgatactatatctgaaaaaatatgtaacatagcaagcaaaattgatgaatct
agtaaattgttttctgaacttaaaaacaataaaaatgtaatgcttaattcagttcaaaat
atatcatccatttgtgaaaaaacagcagcttcatcagaagaagtgtcagcttccacagaa
cagcagactgcttccatggaatctatatctgtagaatccgaaaatttaaaaaaccaaatt
attaaattaaaggaaacttctaagttatttaaaatacgctaa

KEGG   Clostridium carboxidivorans: Ccar_01470
Entry
Ccar_01470        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_01470
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_01470
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_01470
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_01470
SSDB
Motif
Pfam: MCPsignal 4HB_MCP_1 HAMP cobW FtsX LprI
Other DBs
NCBI-ProteinID: AKN29584
UniProt: C6PWR2
LinkDB
Position
302568..304406
AA seq 612 aa
MKWFYNLKVATKLLTGFILVAIIAGMVGVVGVVNIKKIQILDADMYNRHTATMDDMAMIL
EYYQMERVSLRDVILAKDNLQRQKFISKFSDIDRKMAASLEVFQAGIKDPKVLENFNNLK
KALDDFKAYRDREITLVNANQVDQAIASLYTDGVSIANNLQTASDSLLINKIDLAKQSAD
TNKSTANLAVVMMTVIILVGVIIAIGLGIFISRIISKPVNMIAKAADKLAVGDVNVNIEL
DRKDELGSLAESFKRMIASIQGQALAVERIAAGDLTVEVSVKSENDLLGRKLSEMVENNN
GVLTNISTAAEQVASGSRQVSDSSVALSQGATEQASSVEELTASLEEISSQTKVNAENAN
QANELAEAAKANAVQGNAQMNEMLKAMEDINDASSNISKIIKVIDEIAFQTNILALNAAV
EAARAGQQGKGFAVVAEEVRNLAARSANAARETTDMIEGSINKVEGGTKIARDTADALNE
IVNGVEKVANLVNNIAIASNEQAVGIGQINQGIMQVSQVVQSNSATSEEVAAASEELSSQ
AILLKEMVTKFNLKKNIKYYNDLGELNPEVLKMLDRMAEKKNSRSIATNNAYEEAVVTKA
KIALSDKEFGKY
NT seq 1839 nt   +upstreamnt  +downstreamnt
atgaaatggttttacaatttaaaggttgctacaaagcttttgacaggtttcatacttgtt
gcaattattgcaggtatggttggagtagttggtgttgtaaatataaaaaaaatacagata
cttgatgcggatatgtataacaggcatacggcaactatggatgatatggcaatgatatta
gaatattatcagatggaacgtgtgagtttaagggatgtaattttagctaaagataatttg
caaagacaaaaatttattagtaagtttagtgacatagacaggaaaatggctgctagttta
gaggtttttcaagcaggaataaaagatccaaaggttcttgaaaactttaacaatttaaag
aaagcattagatgactttaaagcttatagggatagggaaataactcttgtaaatgcaaat
caagtggatcaggcaatcgcaagcttatatactgatggggttagtatagcaaataatttg
caaacggctagtgatagcttactaataaacaaaatagatcttgcaaagcaaagtgcagat
acaaataaatctacagctaatttagctgtagtaatgatgactgttataatacttgttggt
gtaattatagccattggacttggaatcttcatatcccgcattataagtaaaccagtaaat
atgatagctaaagctgctgataaacttgcagttggtgatgtaaatgtaaatattgaatta
gatagaaaagatgaactaggcagtcttgcagaatcctttaagagaatgatagcaagcatc
caagggcaggctttagctgttgaaaggatagctgcaggtgatttaactgttgaagtttca
gttaaatcagaaaatgatttacttggaagaaaattatctgaaatggttgaaaataacaat
ggggtcttaacaaatatcagcactgctgcagaacaggtggcttcaggttcaagacaggta
tcggattcaagtgtagctctttcacaaggtgcaacagaacaggcaagttcagttgaggag
ctgacagcttctcttgaggaaatatcttcgcaaacaaaagtaaatgcggaaaatgctaat
caagcaaatgaattggctgaagctgcaaaggcaaacgctgtgcagggtaatgctcagatg
aatgaaatgcttaaagctatggaagatataaatgatgcttctagtaatatttcaaagatt
attaaagttattgacgaaatagcattccagactaatatccttgcacttaatgccgctgtg
gaggctgcaagagccggtcagcagggtaagggatttgctgttgtagcagaagaagtaaga
aatctggctgcacgttcagcaaatgcagccagggaaacaacagatatgattgaaggctca
ataaataaggttgaaggtggtacaaagattgcaagggatactgctgatgctcttaatgaa
atagtaaatggcgttgaaaaggtagccaatcttgtaaataatattgctattgcttcaaac
gaacaggctgtaggcattggacaaattaatcagggaattatgcaggtatcacaggttgtt
caaagtaattcagctacttccgaggaagttgcagcagcaagtgaagaactttctagtcaa
gctatacttcttaaagaaatggttactaagtttaacttgaagaaaaatattaaatattat
aatgacctaggtgaattaaatccggaggtattaaaaatgcttgacagaatggctgaaaag
aagaatagcagatcaattgctacaaataatgcatatgaagaagctgtagttacaaaagct
aagattgcattaagtgataaggaattcggaaagtattag

KEGG   Clostridium carboxidivorans: Ccar_01915
Entry
Ccar_01915        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_01915
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_01915
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_01915
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_01915
SSDB
Motif
Pfam: MCPsignal dCache_1 DUF1664 HAMP T7SS_ESX_EspC ApoLp-III Syntaxin-6_N IFT57 DUF4064 DUF948
Other DBs
NCBI-ProteinID: AKN29670
UniProt: C6PYK2
LinkDB
Position
421097..423097
AA seq 666 aa
MKSIKAKLLTYFGTLLICGCIILGIIAYASSNYILGKNTKELLTETATQSAKLVTNRLDS
KKAILETIAQRDDIRDMNIPFEKKAAILKSEVSRTGFSSMGIGNLNGEVNTFDGGHAVIK
DRPYYQEALKGKSVVSDPIKSKTDGKLIINVAVPINDKDGKQVGVLLGATNAAELSSITN
DIIVGKSGKAFIINKAGVTVANYNKDSVEKGENVIEEAKKDSSIQGLANIQKEMIKGGIG
ASEYMYQGQHKYIAYAPINSTGWSIGINVLQSEILSELSTLRLFIALGSIIIIIIGVLLA
YFVSKAIANKVTSISSHLKLLAKGDFSVKIPEKFLNSKDEIGDALRSLAKMHDDLVALIK
ELIGKSKEMSSSSEELYGTVKELTRKAESIEKAVNDIADGVHETSAVSEEISASIEEVDS
SINELSEKAAEGTNNANGAKERATEVRNNSEAAIREVRKMSAEKENNMMKAMEEGKVVEN
IKSMADTIASIAEQTNLLALNAAIEAARAGEQGKGFAVVSEEIRELAEQSAEAVKSIQET
IVKVQGAFKNSTDTGKEVLEFINKDLYEQFDAYAKTGNQYYDDSDFVSKMSEEIAAMSEE
ITATVGQVSNAVQNMAETAQKSNEKSETIKTNVYDTTKAIEQVALTAQVQSELAQKLNEM
VEKFKI
NT seq 2001 nt   +upstreamnt  +downstreamnt
atgaagagtattaaagcaaaattgttaacttattttggtacattgctgatatgtggctgt
ataattcttggtattatagcatatgcgtcttcaaattatatattaggtaaaaatacgaaa
gagttgttaacggaaactgcgacgcaatctgcaaagttagttactaatcgtttagattct
aaaaaagctattttagaaaccattgctcaaagagatgatataagagatatgaatatacct
tttgaaaaaaaggctgccatacttaaaagtgaagtttcaagaactggttttagcagtatg
gggattggaaacttaaatggtgaagttaatacttttgatggaggacatgcagtaattaaa
gataggccttattatcaagaagcattaaagggtaaatctgttgtttctgatccaataaaa
agtaaaactgatggaaaattaattatcaatgtggcagtacctattaatgataaagatggg
aaacaagtaggtgttttattaggagctacaaatgcagctgaattaagttctattactaat
gatattatagttggtaaaagtggtaaagctttcattataaataaagctggtgttacagta
gctaattataataaagattcggtggaaaaaggtgaaaatgtaattgaagaagctaaaaaa
gattcttccatacaaggattagcaaatatacagaaagaaatgattaaaggaggtattggt
gcaagcgaatatatgtatcaaggacagcataaatatattgcttatgcacctataaatagt
actggatggtctattggaattaatgttttacaaagtgaaattttatctgaattatctaca
ttaaggttatttatagcattaggatctataattatcattattattggagtattacttgct
tattttgtatcaaaggccattgcaaataaggttacaagtatttcatcgcatttaaaatta
ttggcaaaaggtgattttagtgtaaagatacctgaaaagtttttgaatagtaaggatgaa
ataggagatgctttaagatctttagctaaaatgcacgatgatttagttgctttaataaag
gaattgataggaaaatctaaagagatgagcagttctagtgaggaattatatggaactgta
aaagaacttacaagaaaagcggaaagtatagaaaaagcagtaaatgatatagcagatgga
gttcatgaaacaagtgcagtatcagaggagataagtgcatctatagaagaagtagattct
agtattaatgagctttcagaaaaagctgcagaaggaactaacaatgcaaatggagctaaa
gaaagagctactgaagttagaaataacagcgaagcagctataagagaagtccgaaaaatg
tcagctgaaaaggaaaataatatgatgaaggctatggaggaggggaaagtagttgaaaat
attaaatccatggcagataccatagcaagtattgcagaacaaacaaatttacttgcacta
aatgcagctatagaagcagcaagagcaggtgaacaaggaaaaggttttgcagtggtatca
gaagaaataagagagcttgcagaacagtcagcagaagctgtaaaaagtattcaagaaacc
atagtgaaagtgcaaggagcgtttaaaaatagtaccgatactggaaaggaagtattagaa
tttattaataaagatttatatgagcaatttgatgcttatgcaaaaactggtaatcagtat
tacgatgattctgattttgtaagtaaaatgtctgaagaaattgctgctatgtcagaagag
attactgccacagtagggcaagtaagcaatgcagtacaaaatatggcagaaacagctcaa
aaatctaatgaaaaatcagaaactataaagacaaatgtatatgataccacaaaagctata
gagcaggtggcattaacagctcaagttcaatctgagcttgctcaaaagcttaatgagatg
gtggaaaaatttaagatttaa

KEGG   Clostridium carboxidivorans: Ccar_01970
Entry
Ccar_01970        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_01970
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_01970
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_01970
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_01970
SSDB
Motif
Pfam: MCPsignal 4HB_MCP_1 TarH HAMP Mce4_CUP1
Other DBs
NCBI-ProteinID: AKN29679
LinkDB
Position
complement(435136..436863)
AA seq 575 aa
MFKNLKMLYKISILSVILLSFCFIISFTGYYFNGKSNKDISNIHNQNIKAINIMDDMRIQ
SRTVQYDLLNLIQNNGNKQNQKAFLDEIDSKFKGIKNDLAEYKTLNLTQSEKDSVNKLEK
QLPKYTEVCTKIRDMSSSGNVKSEDIYAYFSANNTSVLDSFRSGANALVKYHMKKVDETY
NQTQIAYNQSLRMSTIILIIAILLGALLTVLIVKPIVFSLNAATNYLGILATGDFTKDIP
PNLLSSKDEFGTMLQAIDKMKISIREALISVINESSSIKSMLNNADNSLIKLNMDIQDVS
ATTEQLSAGMEETSASTQEINATSHQIKDTIEDVTYKAKETALRSKEISSRATSVKSIAL
SSQKSANEVYSSTNKNLKNAIEKSKAVEQIKVLSDTILQITSETNLLALNAAIEAARAGE
AGKGFAVVSDEIRKLAESSATTVGEIQNITEIVLNSVKNLTESSNEILEFVDKQVHNDYI
TMVQTGETYNKDAESVFNLSNDFSIATEQIQKLMLNMTESLNGITLASNEGAEGTTNIAS
KTSSVVEMTNYIVEQVHHIKDSADNLEKFSLMFKV
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgtttaaaaatttaaaaatgctatataaaatttcaatattatctgttattttattatca
ttttgttttattatcagttttacaggatattattttaacggaaagtcaaataaagacata
tctaacattcataatcaaaatattaaagctataaatataatggacgacatgcgaatacag
tccagaactgtacaatatgatttacttaatttaattcaaaacaatggaaataagcaaaat
caaaaggctttcttagatgaaatagattcaaagtttaaaggaataaaaaatgatcttgct
gaatataaaacccttaatttaactcaatcagaaaaagattctgtgaataaactagaaaaa
cagttaccaaaatacactgaagtatgcacaaaaataagagatatgtcttcttctggaaat
gtaaaatctgaagatatatatgcttatttttctgctaacaacacaagtgttttagacagt
tttcgttctggagcaaatgctctagttaaataccatatgaaaaaagttgatgaaacatat
aatcaaactcaaatagcttataaccaatctctaaggatgtctacaattattttaattatc
gctatacttctgggtgctttgcttacagttttaatagtaaaacctattgtattttcatta
aatgcagcaacaaactatctgggaatactcgctacaggagattttactaaagatatacca
cctaacttattaagcagtaaagatgaatttggcacaatgctgcaggctatagataaaatg
aaaatttctataagagaagctttaatatctgtaattaatgagtcctctagtattaagtct
atgctcaacaacgctgataatagtttaataaaactaaatatggatatacaagatgtatct
gcaacaacagagcagctttcagctggtatggaagaaacttctgcatccacacaagaaatt
aatgctacatcgcatcaaataaaagacactatagaggatgttacctataaagctaaagaa
actgctctaagatcaaaggaaataagtagtagagcaacttcagtaaaatcaatcgcgtta
tcctctcaaaaaagtgcaaatgaggtatattcttcaactaataaaaatttaaaaaatgca
atagaaaaatcaaaagcagttgaacaaatcaaagttctatctgataccatattacaaatc
acatctgaaactaatcttcttgcactaaatgcagctatagaagctgctagagctggtgaa
gctggtaaaggatttgcagtagtatcagatgaaataagaaagctagcagagagctctgca
accactgtaggtgaaatacaaaacataacagaaatagtattaaactcagtaaaaaatcta
acagaaagctctaatgaaatattggaatttgttgacaaacaagtacataatgactatatc
acaatggttcaaacaggagaaacctataataaggacgcagaaagtgtcttcaatttatcc
aatgattttagcatagcaactgaacaaatccaaaagctaatgttaaacatgaccgaatca
ttaaatggaataactttagcctcaaatgaaggtgctgaaggtactacaaatatagcttct
aaaacatctagtgtagtagaaatgacaaattatatagttgaacaagtacatcatataaaa
gatagtgcagataaccttgaaaaattttcattaatgtttaaggtatga

KEGG   Clostridium carboxidivorans: Ccar_02060
Entry
Ccar_02060        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_02060
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_02060
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_02060
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_02060
SSDB
Motif
Pfam: MCPsignal dCache_1 CK2S HAMP_2 DUF1664 ECF-ribofla_trS Retrotrans_gag DUF21 TMP_2 APG17
Other DBs
NCBI-ProteinID: AKN29694
UniProt: C6PVH7
LinkDB
Position
462438..464105
AA seq 555 aa
MKKERLLSVFMCVFIVISIIFSVIFYSFFNHLFHNGGNPEQIILYSSIIFTIFNLIIIII
LGITFFDFFMKSFAETDNLLYSISQGDLTKKVDLNRKGVVHSLYINLNNLIVKFRGLVAQ
IMTMIDKTINYTNDLNEDAENVKRYNKETTSVINHISKRMEEQMVFIKNAKDYSVDVISS
AENIADRSETISKMTHANQKTINDSYKNFEDLILKMNESAKASMETIDRIKKLGEKTSTI
QSIVDQVSEISEETNLLALNASIEAARAGESGKGFAVVAEEVKVLAESSSQQAKEIQSIV
DGIKNEIIGISSRVEYETKSINEYIEVSKIAKEYLNKMHEDTKGTFTAFAEIGAEIEEQV
NKVNKIGSIVENACETFESISASTQEVAASSQEQYSITENTVNRLGKLLDMNKQLENYIS
GFIKNYKIDEKTKKYINSGMESLKKLAKIPELQTMEYRKCTNILKEKIKNNSYFELIALM
QKDGLRKAITLDYKEDQVYVNFAHRPYFKEAILGKEFMSEPYISVDTNNYCIAMSVPIRN
EKGEILGILMADLVL
NT seq 1668 nt   +upstreamnt  +downstreamnt
gtgaaaaaggaaagattattatcggtttttatgtgtgtatttatagtaatatcaataatt
ttttctgtaattttttacagctttttcaatcatttatttcataatgggggtaatccagag
caaattatattatatagcagcataatatttactatttttaatttaattatcattattata
ttaggaataacattttttgatttttttatgaaaagttttgcagaaacagataatttgtta
tacagtatatctcaaggggatttaactaaaaaagtagatttaaatagaaaaggtgtagta
catagtttatatattaatcttaataatttaatagttaaatttagaggtttggtagctcaa
ataatgactatgattgataaaactataaattatacaaatgatttaaatgaggatgcagaa
aatgtaaagcgttataataaggaaaccaccagtgtaataaatcatatatctaaaagaatg
gaagaacaaatggtgtttataaaaaatgccaaggattattctgtggatgttataagttca
gcagaaaatatagctgatagatctgaaactattagtaaaatgacgcatgcaaatcagaaa
actataaatgatagttataaaaattttgaagatttaatacttaaaatgaatgaatctgca
aaagcaagtatggaaacaattgatagaataaaaaaactaggggaaaagacttctacaatt
caaagtattgtagatcaagtaagtgaaataagtgaggagactaatttattagctttaaat
gcgtctatagaggcggctagagcaggggaatcaggtaagggttttgctgttgtagcagaa
gaagttaaagttttggcagaaagttcttcgcagcaagcaaaagaaattcaatccattgta
gatggtataaaaaatgaaataatcggtatatcctctagagttgaatatgaaactaagtct
attaatgaatacatagaagtttcaaaaattgcaaaagaatatttaaataaaatgcatgaa
gatactaaaggtacttttactgcatttgctgaaattggagcagaaatagaagaacaagta
aataaggttaataaaataggttctatagttgaaaatgcttgtgaaacctttgaaagcata
tctgcttcaactcaggaagtggcagcatcttctcaagagcaatattccattactgaaaat
actgtgaatagacttggtaaacttttagatatgaataagcagctagaaaattatatatct
ggttttataaaaaattataaaatagatgaaaaaactaagaaatatataaatagcggcatg
gagtccttaaagaaattagctaaaatacctgaattacagactatggaatataggaaatgt
actaacattttaaaagaaaaaataaaaaataatagctattttgaattgattgcactgatg
caaaaggatggcttaagaaaagctattacattagactataaagaagatcaagtgtatgtt
aactttgctcatagaccttattttaaagaagctatattaggtaaagagtttatgtctgaa
ccatatatatctgtagatacaaataattattgcattgcaatgtcagttcctataagaaat
gaaaaaggtgaaatattaggaatacttatggcagacttggtgctttaa

KEGG   Clostridium carboxidivorans: Ccar_02100
Entry
Ccar_02100        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_02100
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_02100
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_02100
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_02100
SSDB
Motif
Pfam: sCache_3_3 MCPsignal Cache_3-Cache_2 sCache_3_2 HAMP DUF948 dCache_3 Prominin SepF Sec34 HAMP_2 HSBP1 Laminin_I
Other DBs
NCBI-ProteinID: AKN29702
UniProt: C6PVG9
LinkDB
Position
472441..474141
AA seq 566 aa
MNRIIKFKFKGKIISVITLMLLFLASAILSIVYYKINGIVEENVNNQLKISNNSGYRILN
EKYQGDWKIEGGNLLKGKKILNEDTELVDNIKTDTNSICTIFLNDTRVSTNVTMDGKRAV
GTKMSDKVADVVLKQGKAYEGEAVVVGSVYQTRYTPIKDSSDKVIGAFFVGVEKENIVSK
VRNIMVIIVLVSLGAIALGIILATIMVKRISKNINKIQEFLQNISNGDLKSTCEINSNDE
TKEIAQHLNNTTATFKKMIENVMEESENIKHVVDDVSVKVDGLNSNIEDVSEDTEELSAG
MEQTAASSQEMNTTAQEIEKSVESIAKNSQNAVNEVLEISKRAVYTKESVNDAQRKASDV
FLKTKEELEKAIENSKIVEQINVLSESIIQITSQTNMLALNAAIEAASAGEAGRGFSIVA
EEIRKLAEQSKNTVMQIQSVTGKVTASVNELSNSSNKLLDFVSNDVQNDYKTLLDVADKY
SEDAKFVDELIKNFNSTSEELLIRIKDVLKSIDGMAKLSGEGVSATTDIAQKVMDITLKS
NDIFKLTKKSKNSSEKLKEQISKFDI
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgaacagaataataaagtttaagtttaaagggaagataatttccgttatcactttaatg
ttactattcttggcttcggcgattttatctattgtatattataaaattaatggcattgtt
gaagaaaatgtaaacaatcagcttaaaattagtaacaatagcggttatagaattttaaat
gaaaaatatcaaggggattggaaaatagaaggtgggaaccttcttaaaggtaaaaagata
ttaaatgaagatactgaattggtagataatataaaaactgatactaattctatatgtact
atatttttaaatgatacaagggtttcaactaatgtcacgatggatggaaaaagagctgta
ggaactaaaatgtctgacaaagttgctgatgtagttttaaaacaaggaaaagcatatgag
ggtgaggcagttgtagtaggaagtgtatatcaaacaagatatacaccaattaaagattcc
agtgacaaagttataggtgctttctttgttggagttgaaaaggaaaatatagtttccaag
gtaagaaatattatggtaataattgtattagtatctttaggtgccatagctttaggtatt
attcttgccactattatggtaaaacgcatatctaaaaacattaataaaatacaagaattt
ctacaaaatatttcaaatggagacttgaaaagtacttgtgagataaattcaaatgatgaa
actaaagaaattgcacagcatttaaacaacactacagcaactttcaagaaaatgatagaa
aatgtaatggaggaatcagaaaatattaagcatgtagttgatgatgtttcggtaaaggtt
gatggattgaattcaaatatagaggatgtgtcagaagatacagaggagttatctgcaggt
atggagcaaacggcagcatcgtcacaagaaatgaatactactgcccaagagattgaaaaa
tcagtagaatccatagcaaagaattctcaaaatgctgtaaatgaagttttggagattagt
aaaagagcagtttatacaaaagaaagtgtaaatgatgcacagagaaaggcttctgatgtt
ttcttgaaaacaaaggaagaacttgaaaaagctattgaaaattcaaaaattgtagaacaa
ataaatgttttatctgagtctataatacaaataacttctcaaaccaatatgcttgcatta
aatgcagctatagaagctgctagtgcaggagaggcaggaagagggttttcaatagtagct
gaggaaattaggaagcttgcagaacagtcaaagaatacagttatgcagatacaaagtgtt
acaggaaaagttacagcatcagttaatgagctttcaaacagttcaaataagttacttgat
tttgtatctaatgatgtgcaaaatgactataaaacgctgcttgatgttgcagacaagtat
agcgaagatgcaaaatttgtggatgagcttattaaaaattttaattctacttcagaggaa
ttattgattagaataaaagatgtattaaaatctattgatggtatggctaaattatcaggt
gaaggagttagtgcaactactgatattgcacaaaaagtaatggatataactttaaaatcc
aacgatatttttaagttgacaaagaaatccaagaatagttctgaaaaattaaaagaacaa
atttccaaatttgatatttaa

KEGG   Clostridium carboxidivorans: Ccar_02115
Entry
Ccar_02115        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_02115
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_02115
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_02115
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_02115
SSDB
Motif
Pfam: MCPsignal dCache_1 dCache_2 HAMP sCache_3_2 Folliculin HAMP_2 sCache_2 DUF4194
Other DBs
NCBI-ProteinID: AKN29705
UniProt: C6Q257
LinkDB
Position
complement(477522..479522)
AA seq 666 aa
MNFKNFKLNSIRTKLVISLISICLIPLIISGAVSYVESKSILNKKLSLTSSQSILQIENG
LTNYFNGFSDIVSLTASNPGIVNVDTDNNTGIVSEILKGVKESDKDILGVYYGTSSGKFT
IYPNAKMPDGYDATKRDWYKQALDNKGKVIITPPYKDAATGNSVVTLAKTVEKNGQVVGV
IGLDCSLTTLSQKISSQKIGTTGYVFISDISGTILAHPNKELVGTKEAANLSFWDKVKSE
NSGFINYTYNGAKKFGVYKTNEFTGWKLVACLNETELSSDTMAILQITSLITLVMVLFAV
GLSLLLSKGIANNIKKLKDVFARASNGDLTVSITATTKDEFKDLAESFNLMMRNISELIN
NVTNSSKTVLDTSSSLANMSEEVTSSITEVSKAIEEVSLGATEQAQNAQKGASEMEDLSA
RLDKINISSKEMDEISKDTKELGSKGLSMIDTLIEKSDKAKIATKSVNDVISAMNESSKQ
INIISETISDITSQTNLLSLNASIESARAGEAGKGFAVVAEEIRTLAEQSQSSTEEIKKI
IAAIQKKSETAVSAINSTEAAVNDQYLAVNKTQEIFNNILKSIETMIVKVDEVKMSIVDI
NDKKQSTVAEIENISSISEQTASASQEVTASTEEITATMENFTQHSNKLQMLAKQLETQI
TKFKVN
NT seq 2001 nt   +upstreamnt  +downstreamnt
atgaacttcaaaaatttcaagctaaatagtattcgcaccaaattagttattagtttaata
tcaatttgtttaattcccttaatcatatctggagccgtttcttatgtagaatcaaaatca
atacttaacaaaaaattgtctcttaccagttctcaatcaattttacaaatagaaaatggt
cttactaattacttcaatggattttcagatatagtttctcttaccgcgagtaatccaggc
attgtaaatgttgatacagacaataatactggaattgtatcagaaatattaaaaggcgta
aaggaaagtgataaagatatacttggagtatattatggaacttcctctggaaaatttaca
atataccctaatgcaaaaatgcctgatggatatgatgcaaccaaaagagattggtataag
caagctttagacaataaaggaaaagttataataactcctccttacaaggatgctgctact
ggaaatagtgttgttacgcttgcaaaaacagtagaaaaaaacggacaagtagttggagtt
attgggctggattgctcattaactactctttcacaaaaaatatcttcacaaaaaataggt
actacaggatatgtgtttatttctgatatatcaggcactattctagctcatcctaacaaa
gaacttgttggtacaaaggaagctgctaatttatccttttgggataaagtaaaatcagaa
aatagcggttttataaattatacatataatggtgctaaaaaatttggagtatataaaaca
aatgaattcacaggctggaagttagtagcctgcttaaatgaaactgaactttctagcgac
acaatggccatattacaaataacttctttaataacattagtaatggtattatttgcagtg
ggtctatccttattattaagtaagggaattgctaataacattaaaaagttaaaagatgtg
tttgctagagcttcaaatggagatttgacagtatccataaccgctacaacaaaagatgaa
ttcaaggatttagctgaatcattcaatttaatgatgagaaatatatcagagcttataaat
aatgtaacaaattcctctaaaactgtactagatacatcctcaagccttgctaatatgtcc
gaggaagtaacatcttccataactgaagtttcaaaagcaatagaagaagtttctttaggt
gcaacagaacaagcacaaaatgctcaaaaaggtgcttcggaaatggaggacttatccgct
agattagataaaattaatattagttctaaagaaatggatgaaatttcaaaggacactaaa
gaattaggctcaaaaggactttctatgatagatactttaatagaaaaatcagataaagct
aaaatagctaccaaatcagtaaatgatgtaattagtgctatgaatgaaagttctaagcag
ataaatattatatctgaaacaatatctgatataacatcacaaactaatcttttatcatta
aatgcaagtatagaatccgcacgtgctggcgaagctggtaagggatttgctgtggttgca
gaagaaataagaactcttgctgaacaatcacaaagttccacagaagaaataaagaaaatt
atagctgctatacagaaaaaatcagaaacagcagtaagtgccattaattcaacggaagct
gcagtaaacgatcagtatttagcagtaaataagactcaagaaatatttaataatatttta
aaatccatcgaaacgatgattgttaaagtggatgaagtaaaaatgtctattgttgacata
aatgataaaaaacaatctacagtagctgaaattgaaaatatttcatctatatctgagcaa
acagcttctgcttcacaagaagttactgcttctacagaagaaataaccgctactatggaa
aactttacacagcattcaaacaagcttcaaatgttagcaaaacagttagaaacacaaata
actaagtttaaagttaactaa

KEGG   Clostridium carboxidivorans: Ccar_02165
Entry
Ccar_02165        CDS       T03979                                 

Definition
(GenBank) hypothetical protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_02165
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_02165
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_02165
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_02165
SSDB
Motif
Pfam: MCPsignal dCache_1 HAMP Fib_alpha
Other DBs
NCBI-ProteinID: AKN29713
UniProt: C6PYI5
LinkDB
Position
491138..493117
AA seq 659 aa
MLKSIRLKIVLAVTLIICIFSVGLGIASTMFSKKVIEQQYCKDYIKLNDETVKILIKTIE
GFGSGISTVTENSNMKEIIVHPDFKLYTVDALKAFQVSNPDIALAYIGTEEGKAITYPEL
DLKLDPRTRSWYEEAKKSDSVIWTNPYVDAASGGVIITGAKAVHKDGQLVGVVGADLQLD
YLNKIMSEVKFSQTGVSYIVNKSTGKIITHKDKKLLSTPIDKDILKEITQNQNGSKIIYD
KNNVKKILIYNYIKILDSTLITEINYTEISQTTNDIKKVIIIFALIITIILILIAYVGSG
KVVKYINLVKDEMKYLEGGDFSRKIKNIKRKDEIGQLCNSFNSMVGNVRKLIISTQGVGN
EVMNASENLFSSAEETNASAVEVSHAIREISIGAEKQTQEIQKTVNISNELSQSLDQLLK
SSDLLNKEMENTLIVNKQGINMLKELSEQSEKTKKSNIEVGQAIVKLDNSTETIYEILES
IKSIAAQTNLLALNVSIEAARAGEAGNGFNVVAMEIRKLAEESDAATRSIDKILESTRTE
SKNTVSIMKNVKSIHIEQEKAVENVSIAFEQISSSVEKSAGRIEETINKIDELRIREKAI
KNTVSSISQISEEASISSEEVTASMQCQLSAVENISKSAESLTELALNLRKSLSEFKLE
NT seq 1980 nt   +upstreamnt  +downstreamnt
gtgttaaaaagtatacgattaaaaattgtacttgcagttaccttaataatatgtattttt
tcagttggtttaggtattgctagtacaatgttttcaaagaaggtaatagaacaacaatac
tgtaaagattatataaaacttaatgatgaaacagtaaaaatattaataaaaactattgaa
ggctttggaagtggaatctccacagtaactgagaattcaaatatgaaggaaattattgtc
catcctgatttcaaattgtatacagtagatgcgcttaaagcatttcaggtttctaacccg
gatattgcccttgcgtatattggaacagaagaaggtaaagccattacatatcctgaactt
gatttaaaattagatccaagaacaaggagttggtatgaagaagctaaaaaaagtgattct
gttatttggacaaacccctatgttgatgctgcatctggaggtgttattattacaggagca
aaggcagttcataaggatggtcagcttgtaggagttgttggagcagatcttcaacttgat
tatctaaataaaataatgtcagaggtaaagttttcacaaactggagtgagctatatcgta
aataaatctactggaaaaataattacgcataaggataaaaaattactatcaacaccaatt
gataaagacatattaaaagagataacccaaaaccaaaatggaagcaaaataatctatgat
aaaaacaatgtaaaaaaaatactaatctataactatataaaaatcttagattcaacactt
attacagaaataaattatacagaaatcagtcaaacaacaaatgatattaaaaaagtcata
ataatatttgctttaattattacaattatattaatactgattgcttatgtgggttcaggg
aaagttgttaagtatatcaatcttgtgaaggatgaaatgaaatatcttgaaggaggagat
ttttctagaaaaataaaaaatattaaaagaaaagatgaaattggtcagctgtgtaacagt
tttaattccatggtaggaaatgtaaggaaacttataatatccacccaaggtgttggaaac
gaagtaatgaatgcatctgaaaatttattttcttctgctgaggaaacaaatgcatctgca
gttgaagtttcccatgcaattagagaaatctctataggggcagaaaagcaaactcaggaa
attcaaaaaactgttaatatatctaacgaactatctcaatcacttgatcagttattaaaa
agcagtgatttacttaataaagaaatggaaaatactttaatagtaaacaagcagggaatt
aatatgcttaaagaacttagtgaacaaagtgaaaaaacaaaaaaatcaaatattgaagtt
ggacaagccatcgtgaaacttgataacagcacagaaactatatatgaaatacttgaaagc
ataaaatctattgcagctcaaacaaatttgctggcattaaatgtttcaatagaagctgca
cgagcaggagaagctggaaatggatttaatgtagttgcgatggagataagaaaattagcc
gaggaatcagatgctgcaactagaagcattgacaaaatacttgaaagcaccaggactgaa
agtaaaaacactgtttctataatgaaaaatgttaagagtattcatattgaacaagaaaaa
gcagtagaaaatgtaagcattgcctttgaacagatatcaagttcagtagaaaaatctgca
ggcagaatagaagaaactattaataaaattgatgaattaagaattcgagaaaaagcgata
aaaaatacagtgagtagtatttctcaaatttcagaggaagcatctatttcttctgaggaa
gttactgcttcaatgcaatgtcagctttcagctgtagaaaatatttcaaagagtgcagaa
tcgcttacagagcttgcgttaaatttacgaaaaagtctgtcagaatttaaattggagtaa

KEGG   Clostridium carboxidivorans: Ccar_02395
Entry
Ccar_02395        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_02395
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_02395
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_02395
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_02395
SSDB
Motif
Pfam: MCPsignal Laminin_I PhoU_div Phasin_2 Med20 Sec34 Laminin_II Crescentin T3SchapCesA
Other DBs
NCBI-ProteinID: AKN34090
UniProt: C6Q0J4
LinkDB
Position
549531..550514
AA seq 327 aa
MLKVIEQTNDVEKNGNENSTKFEADSWIKTSCGHLEEVVSGFSSRSHEMLASANEVANSI
QQVAQGANDQSNEIMKIVELLTSLTKETDLVQGKLFTVHKNTQETETQAVEGEGKIYELI
DFIVKVKNSFDVVMENVNNLSGTVSEIGKITDVINAISEQTNLLALNASIEAARAGEQGK
GFTVVAEEVRKLAEESKVSSGKIVNLVKSISQGTESVLDNSSKVGALLEGQAEVANDTII
SFEDIIASVKNVPVLIKETGESLNKVTENSNSVLDKVKKVSEVSEVTSGTSEEISASCEE
LVASCEEVSKLASKLENEVEDLKNKND
NT seq 984 nt   +upstreamnt  +downstreamnt
ttgctgaaagttattgaacaaactaatgatgttgaaaagaacggaaatgaaaattcaact
aagtttgaagctgattcatggattaaaacatcatgtggacatttagaagaagtagtatct
ggattttctagtaggtcacatgaaatgctagcttcagcaaatgaagttgcaaattcaata
cagcaagttgcacaaggagctaatgatcaatctaatgaaattatgaaaattgtagaactt
ttaacaagtttgacaaaagaaacggatttagttcaaggaaaattgttcactgtacataaa
aatacacaagaaactgaaacacaggcagtagaaggtgaaggtaaaatatatgagctcata
gactttattgtaaaagtaaagaactcttttgatgtagtcatggaaaacgtaaataattta
tctggtactgtatcagaaatagggaaaatcaccgatgtaataaatgctatatcagaacaa
actaatcttttagctttaaatgcatcaatagaggcagctagagctggagagcaaggcaaa
ggttttactgtagtagcagaagaagttagaaagcttgcagaagaatctaaagtttcatca
ggaaaaatagtaaatcttgtaaagtcaatttcccaaggaacagaaagtgtattagataat
tcaagtaaagttggagcattactagaggggcaagctgaagtagctaatgatactataata
tcatttgaagatattatagcttcagtaaagaacgtgcctgtacttataaaagaaacagga
gaatctttaaataaggttacagaaaacagtaattctgttttagataaggtgaaaaaggta
tcagaagtatcggaagtaacctctggaacttcagaagaaatatctgcatcttgtgaagaa
ttggtggcatcttgtgaggaagtttccaagttagctagcaaattggaaaatgaagtagaa
gacttaaaaaataaaaatgattaa

KEGG   Clostridium carboxidivorans: Ccar_02625
Entry
Ccar_02625        CDS       T03979                                 

Definition
(GenBank) hypothetical protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_02625
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_02625
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_02625
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_02625
SSDB
Motif
Pfam: MCPsignal dCache_1 Cache_3-Cache_2 HAMP DUF948 HAMP_2 Lebercilin
Other DBs
NCBI-ProteinID: AKN29800
LinkDB
Position
603330..605330
AA seq 666 aa
MKKKTLRKSLITLLCFSTLIPLLIVGIYSYVSQSKSFRDDFDTILKNNSQEISSVIKKEN
KSYKESLEMIANEASVNNSTTNAEYSKLLLQNLDQFVKSHNDITNAYVATASGNMILAPI
QQLPEGFDPRKRDWYKDSLSKDGQAIVTDPYEDAAKKGNFEVTFAKTVKDASSGQVLGVA
AMDIKLDNLSSLISEKKIGQNGYTLLLDNKGNIIGSKDKSMLKKNTKDLPWISKIMSNGD
NNVYEDTINGSSFRICTVKDSTTGWIIAALIPKSELSERVNHARNVTALISLIAFFIVSI
LGNLFSKFITNPFAELIKVLNKMQNGDFSEKVSKENNSIYEVEMITDSVNVLRDEMVEMI
SSIKNVSDNINTSSNDLKQISQESHVSGEEISKIVSGISEGAVEQAQSMNESEILTTKLG
GEVENSLKRANDMVTIAKGVKESTDNEAKVIHKLSGSFEATAKSNRDVAEQIKRLSEKSN
EISIITETITSITEQTNLLALNASIEAARAGEAGKGFAVVAGEVKDLAEQSEESALRISK
VITEIKENISQLLNKMGNTVVLGKNVDEAMGLTNESFKSIYNSIDKLEESVLIVDSSLKQ
MNKHKDSVLSQIQNVNSVSQEIAATTEEVNASVQEQASGLEKVVKAAGELENLASGLNSL
VDKFNI
NT seq 2001 nt   +upstreamnt  +downstreamnt
atgaagaaaaaaacccttagaaaaagtctcataactttattatgtttttctactttaata
ccattattaatagtaggaatttatagttatgtatcccaaagtaaatcatttcgtgatgat
ttcgacaccatacttaaaaataactctcaagagataagtagtgtcataaaaaaggaaaac
aaaagttataaggaatctttagaaatgatagctaatgaagctagcgttaataattcaacg
acaaatgcagagtatagtaagttgttattacaaaatttagatcagtttgtaaaatctcat
aatgatataactaatgcttatgtggcaactgcttcaggcaatatgatattagcgccaatt
caacagcttccagaaggatttgatccaagaaaaagagattggtataaggattcactaagc
aaagatggacaagccattgtaacagatccatatgaagatgctgctaaaaaagggaacttt
gaagttacttttgctaaaactgtaaaagatgcttctagtggacaagtactaggagttgca
gccatggatataaaattggataatttatcaagcttaatttcggaaaagaaaattggacaa
aatggatatacattgcttttagataataaggggaatattataggaagtaaagataaatct
atgttaaagaaaaataccaaggatttaccatggatttctaagattatgtccaatggagat
aataatgtatatgaagacactataaatggctcaagctttagaatatgcactgttaaagat
agtactactggatggataattgctgcacttatacctaaaagtgaattaagtgaaagagtc
aatcatgcaagaaatgttacagctttaatttccttaattgcattttttattgtatctata
ctaggtaatttattttcaaaatttataactaatccatttgcagagttaataaaagtactt
aataaaatgcaaaatggagatttttcagaaaaggtaagtaaagagaataattctatatat
gaagttgaaatgataacggatagtgtaaatgtgcttagagatgaaatggtagagatgata
agtagtataaaaaatgtttctgataatataaatacatcttcaaatgaccttaagcagata
tcacaagagtcccatgtatcaggagaggaaatatcaaaaatagtttctggaatatctgaa
ggtgcagttgaacaagcacaatctatgaatgaaagtgaaattttgacaactaagcttgga
ggagaagtagaaaattcattaaaaagagctaatgatatggtaactatagcgaagggcgta
aaagaatctactgacaatgaagctaaagtaattcataaattaagtggtagttttgaagca
actgctaaatccaatagagatgtagctgaacaaataaaaagattgtcagaaaagtctaat
gaaattagtattataacagaaactataacgtcaataacagagcagacaaatcttttagct
ttaaatgctagcattgaagcagcacgcgcaggagaagcaggaaaaggttttgctgtagtt
gctggtgaggttaaagatttagcagagcagtctgaagaatctgcacttagaataagtaag
gttataactgaaataaaggaaaatataagccagcttttaaataagatggggaacacagtg
gtacttggtaaaaatgttgatgaggctatggggttaacaaatgaatcctttaaaagcata
tataattctatagataaattagaggaaagtgttctaattgtagatagttcactgaaacaa
atgaataaacataaggattcagttttatctcaaatacaaaatgtaaattctgtatctcaa
gaaatagcagcaactacagaagaggtaaatgcctctgttcaagagcaagcatcaggactt
gagaaggtagtaaaggcagcgggtgaactagaaaatcttgctagtggactaaattcatta
gtggataaatttaacatttaa

KEGG   Clostridium carboxidivorans: Ccar_04060
Entry
Ccar_04060        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_04060
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_04060
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_04060
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_04060
SSDB
Motif
Pfam: MCPsignal dCache_1 HAMP dCache_2 sCache_3_2 Phasin_2 HAMP_2 Peptidase_A8 MAD COG2
Other DBs
NCBI-ProteinID: AKN30043
UniProt: C6PRU6
LinkDB
Position
complement(941307..943388)
AA seq 693 aa
MKSIKNKLITFAVLLVLLPVLITNFVCYYYFSSSISSNVIDNNKKLSSTISDGVKDFIDK
AYTLTEEMAQNKTTIDFNQENQKEMLTNALAKNPYFDLLYIQNTSGKQTARSSGELGDRS
NRWWFTQMMKDKKPFVSKSYYSASGNMAVTSIFHPIFDKNSNMLGIFGADLKLNELQKLV
DKYSDGKNVYSFILDSEGVVIAHPDKTQVSELYNYKTLKKTVLVKDASGNVEKDASGNLK
TKLEDIAIPQTLKETVGKALKGESGVVEYSDNNKKEMLGAYTTIKLPGQSQSWAVVTVEN
KAYAMSVLKSTQLKNTFIALGLLILIAILIYLLAKKFTQPILELVDLMKRASEGDLTVKC
NHKSEDEIGNLSYNFNCMVSQIRDLINNISNTSNLVTDSAKTLAINTDATSQSIDQVTLN
ISDVAAAAEKQTSNSITGLDTTTKLSDEISIMTNYMNEGKMSAEKIYTVSTKGVNIIGSL
ETAAKENNNSINNIAVVVNSLSEKANVIGNIADTITSISEQTNLLALNAAIEAARAGDAG
KGFSVVADQVRKLSEDTASSSNNVKDIISNVQKDVNKAKEAITQAELVVKKQNDAVKYTG
ETFNEISSKIQDVVNKIITTASSLDNVLVSRDQLLILMEDAAKVSETLSASSEHVSAITE
EQNAAMEEVTALAEDLNKMSSTLNESIKIFKLN
NT seq 2082 nt   +upstreamnt  +downstreamnt
atgaaatctattaaaaacaaattaattacttttgcagtattattagtattattaccagtt
ctaattactaattttgtatgttattactatttttccagcagtatatcttctaacgtaatc
gataacaacaaaaaactttcatctacaatatctgatggtgttaaggattttatagataaa
gcctacacacttactgaagaaatggcccaaaacaaaacaactattgatttcaatcaggaa
aatcagaaagaaatgcttacaaacgctttagctaagaatccttattttgacttactttat
attcaaaatacttctgggaaacaaacagctcgttcctctggagaattaggagatagatct
aatagatggtggtttactcaaatgatgaaggataaaaaaccttttgtcagtaaatcttat
tactctgcaagtggaaatatggctgtgacttcaatatttcacccaatttttgataaaaat
tctaatatgttaggaatatttggagccgatcttaaattaaatgaattacaaaaacttgtg
gacaagtattcggatggtaaaaatgtctactcatttattttggatagtgaaggtgttgta
attgctcatcctgataaaactcaagtttcagaactttataattataaaactttgaaaaaa
acagtattagttaaagatgcctctggtaatgtagaaaaagatgcatcaggaaatctaaaa
actaagcttgaagatatagctattcctcaaacccttaaagaaaccgttggaaaagcacta
aagggagaatctggtgttgttgaatactcagataataataaaaaagaaatgttaggtgcc
tatactacaataaagcttcctggtcaatcacaaagttgggcagtagtaacagttgaaaac
aaagcctacgctatgtcagtactaaaatctactcaacttaagaatacttttatagcctta
ggattattaatactaattgccatattaatatatttgttggctaaaaaatttacacaaccc
attcttgaactagtagatttaatgaaaagggcatctgaaggagacttaacagttaaatgt
aaccataaaagtgaagacgaaattggcaacttaagctacaactttaattgtatggtatct
caaattagggatcttattaacaatataagcaatacttcaaaccttgtaacagattcagct
aaaactttagcaattaacactgatgcaacttctcaatctattgaccaagttaccttaaat
atttcagatgttgctgctgctgctgaaaaacaaacttcaaattctattactggacttgat
acaactacaaaattgtcagacgaaatttctatcatgaccaattatatgaacgaaggaaag
atgtctgctgaaaaaatatatactgtcagcactaaaggagttaatattattggcagctta
gaaactgctgcaaaagaaaataataattctataaacaatatagcagtagttgtaaattct
ctaagcgaaaaagctaatgtaataggaaatatagcagatactataacttcaatttcagaa
caaactaatcttttagctttaaatgctgctatagaagctgcaagagctggggacgctgga
aaaggattctctgtagttgctgatcaggttaggaagttatcagaagatactgcttcctca
agtaacaatgttaaagatattatatccaatgttcaaaaggatgttaataaagccaaagag
gccataactcaagcagaacttgtagtaaaaaaacaaaatgatgcagttaaatatactggt
gaaacctttaatgaaatttcctcaaaaattcaagatgtagtaaacaaaattattactact
gcatccagccttgataatgtacttgttagtagagatcaactacttatacttatggaagat
gcagcaaaagtatctgaaactctatcagcatcttctgagcatgtttcagctataacagaa
gaacaaaatgcagctatggaggaagtaacagcactggcagaagacttaaataaaatgtcc
tccactcttaatgaatcaataaaaatcttcaaattaaactaa

KEGG   Clostridium carboxidivorans: Ccar_04615
Entry
Ccar_04615        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_04615
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_04615
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_04615
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_04615
SSDB
Motif
Pfam: 4HB_MCP_1 MCPsignal TarH HAMP DUF1664 VirD1 DUF3540 DUF948
Other DBs
NCBI-ProteinID: AKN30144
LinkDB
Position
complement(1071852..1073564)
AA seq 570 aa
MKLFSNLKMKQKLLSGFLFAALFVLVAGIIGGVGMKKINAVSNELYNSDMKTLQALNEFD
TNTLHLRLEIINLVESRDASKAQDTINTSNTLKNRNNELLSSYKKLNLTPEEKNLVDELD
TELTDWRNICNDILNLMSQGKYDEAANLNKKAASYREKLTTTIEKLVSITVKRADNRNNS
SYITYKSSLLVIISVTLISFIISTLLGIKITNSALKEINKILKFSEDISNGVLNKSIELT
SKDEIGMIAEKLNIAGESIKVLVKEIMQSTDHMNASSQELSATTEEISSMMSSVNESTNQ
IAKGSQNLSSVTEEISASTQEIDENITKLSLKANEAANSSADIKKRAISIKEKASSSIEE
GKTIYDEKRKNIIKAIEDGKIVSEVKTMSASIASISEQTNLLALNAAIEAARAGEQGKGF
AVVAEEVRKLSEESSKSVKSISQMVIAVESAFNNISKSGNDILDYIANVVTPNYQLLMDT
GIQYEKDAEFINDMSNGINNSLNQIKEVVSQVNTAIDDAASTAEQSASGSEEIIGSVNEV
TKAIEDISLSSQSQAELSQKISQMVNKFTV
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgaagttatttagtaatttaaaaatgaagcaaaaattattatcaggatttttatttgca
gcactgtttgttttagttgcaggcataattggtggagttggcatgaagaaaataaatgca
gtgtcaaatgaattatataatagtgacatgaaaactttacaagctttaaatgagtttgat
acaaatactcttcatttgagacttgaaataataaatcttgtagaaagtagagatgccagc
aaggctcaagatactataaatactagtaatacattaaaaaatagaaataatgaactttta
agctcatataaaaaattaaatttaactcctgaagaaaaaaatttagtagatgaactggat
actgaactaacggactggagaaatatatgcaatgacatactaaatcttatgtctcaagga
aaatatgatgaagcagctaatctgaataaaaaagcagcatcctatagagaaaaattaact
acaactattgaaaaattagttagtattactgtaaaaagagcagataatagaaataattca
agttatatcacatacaaaagctcacttttagttataatttctgttactttaataagtttt
attatatcaacattattaggtattaaaattacaaattctgcactaaaggaaattaataag
attttgaaattcagtgaggatataagtaatggagttttaaataaatctatagaacttact
agcaaggatgaaataggtatgatagctgaaaagcttaatattgcaggtgaaagtataaaa
gttttagtaaaagaaataatgcagagtacagatcatatgaatgcttcaagccaggagtta
tctgcaactacagaagaaatttcgtcaatgatgtcttctgtaaatgaatcaacaaaccaa
atagctaaaggttctcaaaacttaagtagtgtcacagaggaaataagtgcatcaactcaa
gaaatagatgaaaacataactaaactttcccttaaggcaaatgaagcagcaaattcttca
gctgacataaaaaaacgtgcaattagtataaaagaaaaggcttcaagcagtatagaagaa
ggcaaaacaatatatgatgaaaagaggaaaaatattataaaagcaattgaagatggaaag
attgtttctgaagttaaaactatgtcagcatctattgcaagtatatcagaacagacaaat
cttcttgcacttaatgcagcaattgaagctgcaagggctggcgaacaaggaaaaggcttt
gctgttgtagctgaagaagttagaaaattatcagaagaatcctcaaagtcagttaaaagt
ataagccaaatggtaattgctgtagaaagtgcttttaataatatatctaaaagtggtaat
gacatacttgattatatagcaaatgtagttacccctaattatcaattactcatggataca
ggaattcaatatgaaaaggacgccgaatttataaatgatatgtcaaatggtataaataat
tccttaaatcaaataaaagaagtagtatcacaggtgaatacagccattgacgatgcagct
tctacagcagaacaatctgcatctggttctgaagaaatcattggaagtgtaaatgaagtt
actaaggcaattgaagatatatcattatcttcacaaagtcaagctgaactttcacaaaaa
atttcacaaatggtaaacaagtttaccgtttaa

KEGG   Clostridium carboxidivorans: Ccar_04845
Entry
Ccar_04845        CDS       T03979                                 

Definition
(GenBank) hypothetical protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_04845
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_04845
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_04845
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_04845
SSDB
Motif
Pfam: dCache_1 MCPsignal dCache_2 Seryl_tRNA_N
Other DBs
NCBI-ProteinID: AKN30185
UniProt: C6PUM7
LinkDB
Position
1121350..1123365
AA seq 671 aa
MKNKIKLSVKKLLMTFIPLFVIIPIFIISIFNGIKVKDNETRNFYDLMSASNGKISNIIA
DMYTNNKKTIDMFSVNDDVVGLKQKPELEASMMKTFNDYIKYHEEIRAIYYGEASKVHHT
TSGKPKPGYDPTSRPWYTKAVQEDGKVALTDPYEDVVKPGTYVVTLAKTVKDPNTKETLG
VIGGDIPLDTISKEISNIKIGNSGYTAVVDQTGTIIAHKDKKLVSKKSKDLKWLDEIIKS
KDSSNIVNIDGQKYLTLKSQNSETGWLTVTFVPNQELSDKIKSLIIPNIMVGLICAILGI
IVSLFISKYLINSIYEIIEILKNIGKGNLSVQIECRDNELKEVSMIKEEINVMKKEIVSI
TDKTIEVSEKLNESAKHFASVTQEVSSSAEEVSGSVSQITEGAANQADHLQESSTSVETL
GELVDNTLKSAKSMEETSGEANKVIENSMKLVDNLKNNLEEGFQVNEELIKEAKVLNSNS
QEIVGIINNIKDIAEQTNLLALNAGIEAARAGEYGKGFVVVAEEVRKLAEQSTIFADEIE
IVIGKMKNSVGMVTEKIKNTKETNMNTKENMVTVDNGFVKVEKNIDELKNHINIVVEALK
NINENKKVVVTKIEEVAAISEEAAAATEEVNAASEEQAANLQDISNSTEDLLLLSEELKK
SISFFSCDKSV
NT seq 2016 nt   +upstreamnt  +downstreamnt
atgaaaaataagattaaattaagtgtaaaaaaactactgatgacgtttataccattattc
gtaataattcctatatttataatttccatttttaatggaattaaggttaaagacaatgaa
accaggaatttttatgatttaatgagtgcaagtaatggaaagatatctaatataatagct
gatatgtatactaataataaaaagactattgatatgttttctgtaaatgatgatgtagta
ggtttaaaacaaaaaccagaattagaagcatctatgatgaaaacttttaatgattatata
aaatatcatgaagagataagagcaatttactatggagaagcttcaaaagttcatcacaca
acttctggaaaaccaaaacctgggtatgatccaacaagcagaccatggtatacaaaagca
gtacaggaggatggaaaggtagcgttaactgatccttatgaagatgtagttaaaccaggg
acttatgtagttactttggcaaaaacggttaaagaccctaataccaaagaaactttggga
gtaataggaggagacataccattagatactataagcaaggaaatttccaatataaaaata
ggaaatagcggatatacagctgtggtagatcaaacgggtactattattgcacataaggat
aagaaacttgtaagcaaaaaaagcaaggatttaaagtggcttgatgaaataattaaatca
aaagatagcagcaatatagtaaatatagatggacaaaaatacttaaccttaaaatctcaa
aatagtgaaactggatggttaacagtgacttttgtacctaatcaagaattaagtgacaaa
attaaatctttaattatacctaacattatggtaggtttgatatgtgcaattttgggtatt
atagtttcattgtttatatcaaaatatttaataaattctatttatgaaattatagaaatt
cttaagaacataggtaagggaaatttaagtgtacaaatagaatgcagagataatgaacta
aaagaagtatcaatgataaaagaagaaattaatgttatgaaaaaagaaattgtatctatt
acagataaaactatagaggtttctgaaaagctaaatgaatctgcaaagcattttgcttca
gttactcaggaggttagctcatcagcagaagaagtttctggttctgtaagtcaaataaca
gaaggagctgcaaatcaagctgatcacctgcaagaaagttcaaccagtgtggaaactctt
ggagaattagtagataatacattaaaaagtgctaaaagtatggaagaaacttcgggtgaa
gctaataaagttatagaaaacagtatgaaattagttgataacttaaaaaacaatcttgaa
gaagggttccaggttaatgaagaattaataaaagaagcaaaagtgttaaatagcaattca
caagaaatagttggtataataaataatattaaagacatagcagaacaaacaaatttatta
gcattaaatgctggtattgaagctgcaagagcaggggaatacggaaagggttttgtagta
gttgctgaggaagttagaaaattagcagaacagtccactatttttgctgatgaaattgaa
atagtaataggtaaaatgaaaaatagcgtaggaatggtaacagagaagataaaaaataca
aaagaaactaatatgaacacaaaggaaaatatggttacagtagataatggatttgtaaaa
gtagaaaaaaatatagatgaacttaaaaatcatattaacattgtagttgaagcattaaaa
aatataaatgaaaataaaaaagttgtagttacaaagatagaagaagtagcagctatttca
gaagaagctgcagcagctacggaagaagtaaatgcagcatcagaagagcaagctgcaaac
cttcaggatatttcaaattcaacagaagatcttttattattatctgaagaattgaagaaa
tcaataagcttttttagctgtgataagtcagtttaa

KEGG   Clostridium carboxidivorans: Ccar_05380
Entry
Ccar_05380        CDS       T03979                                 

Definition
(GenBank) methyl-accepting transducer
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_05380
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_05380
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_05380
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_05380
SSDB
Motif
Pfam: MCPsignal DUF948 DUF294_C
Other DBs
NCBI-ProteinID: AKN30284
LinkDB
Position
complement(1245644..1247173)
AA seq 509 aa
MNTNTSSIVKYQVQTLKFVIIIYSISALLAGSMFSVMKLLGLYEKVKWPYLLGLFLIGIL
EMIFFKIMYKQTVVDGNLNSKMFKNMKITTVIVCYINYFYMNFTIPSRELWVTVFYMITL
TSLFLDNKINIASIILSIICEIILFTLNPYTLPNEFFLRELILRITSIFLVSFGLFAFTW
FASKLLKSIEQNENELRINNENISNLFNKTSEFAKDLLNSSEALASIASEESATMEEISS
TTQSITKDTDKMLKDSSENTKVLNQLLDANKSISIKAKNTETNSISLINLSTKNEKDLNE
TLNIINSIKNSIDNTLDATKILEKKSKQIDEILLIIKQISEQTNLLALNASIEAARAGEF
GKGFSVVADEIRKLAEDTKTSLNDASLITKDVKERVAQVDYLMTDNSEKVNNGDTIINNA
VENIKIMITELKDSGSDINEISQLTTTLLGETKNVVTFNNNIYETMKETISNFNLVDKSI
NETAAVSEELTSSAENLKDIAAEMNKLIS
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgaatactaatacaagcagtatagttaaatatcaagtacaaacattaaaatttgtaata
attatatattccataagcgcattactagcaggttctatgttttcagtaatgaagctatta
ggattatatgaaaaagttaaatggccttatttactgggtttatttttaataggaatttta
gaaatgattttttttaaaattatgtacaagcaaacagtggtagatggaaatttaaatagc
aaaatgtttaaaaacatgaagataactacagttattgtttgttacataaactatttttat
atgaattttaccattccttcgagagaactttgggtaactgttttctatatgattactcta
acttctctattcttagataataaaattaatatagcctccattatattgagtattatctgt
gaaattattctatttactttaaatccatatacattacctaatgagttttttttaagagaa
ttaatacttagaataacttctatattcctagtttcatttgggctttttgcttttacatgg
tttgcatctaaattattaaaatctattgaacagaatgaaaatgaacttagaataaataat
gagaatataagcaatttatttaataaaacttctgaatttgccaaagatttattaaattca
agtgaagctttagcatccatagcttcagaagaaagtgcaacaatggaagaaatatcaagc
actactcaatctattactaaggatacagataaaatgttaaaggactcttccgaaaatact
aaagtacttaatcaacttttagatgctaataaatctatatctataaaagctaagaatacg
gaaactaattctataagtttaatcaacttatctactaaaaatgaaaaagatctaaatgaa
actctaaatatcataaattctataaaaaacagcatagataatacccttgatgccacaaaa
atacttgaaaaaaaatctaaacaaattgatgaaatacttcttataataaaacaaatatct
gaacaaactaatcttcttgcactaaatgcatcaattgaagctgcaagagctggtgaattc
ggaaaaggattttcagttgttgcagatgaaattagaaaacttgctgaagatacaaaaaca
tcattgaatgatgcctctttaatcactaaagatgttaaagaaagagttgctcaagtagac
tatcttatgactgataactcagaaaaagtaaacaatggcgacactattataaataacgct
gttgaaaatataaagattatgattactgagttaaaggactcaggaagcgatattaatgaa
ataagtcaattgactactacccttctaggagaaactaaaaatgttgttacatttaacaat
aacatttatgaaactatgaaagaaaccatatcaaatttcaatttagttgataaatcaata
aatgaaactgcagcagtaagtgaagaattgacaagcagtgcggaaaacttaaaggacata
gctgctgaaatgaataaattgatttcataa

KEGG   Clostridium carboxidivorans: Ccar_05465
Entry
Ccar_05465        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_05465
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_05465
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_05465
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_05465
SSDB
Motif
Pfam: MCPsignal sCache_3_2 Podoplanin HAMP sCache_3_3 DUF4407 DUF948 UPF0242
Other DBs
NCBI-ProteinID: AKN30296
UniProt: C6PSS5
LinkDB
Position
1274403..1276109
AA seq 568 aa
MSRLGLKVLRLVSIVVGIVVLISFISYGIIFKNVEVKLKESAKASIAESINVVDKDKIEK
VLKDNSNKSKEYKEVLNSMTVFKAKKDIKNFYIYIKKDDKNVQFLFDASPEPAEYMENYE
MQKEISSAFEGNIVVSDKAYSDKWGTYVSAYAPIKSSSGQVIAIIGADEDISTFQNIKQL
FFRIAILEIIVAIIISLLSVWLFSKKLKYNIGIIQNKLENMSKGNLQENIEIKTKDEIEE
IASFLNDFRLKVNDMLINIKNDVSTAQESSDGLYNTAKDIALASEHVASITQGVSENSVK
QTSDILSIKENFNEFGRVIDNTVKIVSEFDTMANNIKEKSKESSKDVSLLINSINDLNIH
FKAVIEKIHGLGSSIDKINDITNLINDISDQTNLLALNASIEAARAGESGKGFSVVAEEI
KVLAEQSKISSKNISELLKNLSEQSNMVVINTKNVDSQFSNQITIVNGIASSFGGIIGDM
EKLLPGINLVNNSMIEVNSKKSIILSNLSDSSSASEEISASSEEISSLSEELNGSTEEVS
NAAEKLLGMVNDVMNNVNNFKTEGKSLD
NT seq 1707 nt   +upstreamnt  +downstreamnt
atgagtagacttggtttaaaagttcttagactagtgtctatagtagttggaattgttgta
ttaatatcttttataagctatggtattatatttaagaatgtggaggtgaagttgaaggag
agtgctaaagcatctattgcagaatcaattaatgttgttgataaagataaaatagaaaag
gtattaaaagataactctaataaatctaaagaatacaaagaagtattaaattcaatgaca
gtatttaaagcaaaaaaagatataaaaaacttttatatttatataaagaaagatgataaa
aatgttcaatttctttttgatgcttcacctgagcctgctgaatatatggaaaactatgaa
atgcaaaaggaaatttctagtgcttttgagggcaacattgttgttagtgacaaagcatat
tcggataagtggggaacatatgtatcagcctatgcaccaataaaaagttcatctggacaa
gttatagctattattggagctgacgaggatatttcaacttttcaaaatattaaacagttg
ttttttaggatagccattttagaaatcatagttgctattatcatatcgttattatcagta
tggttattttcaaagaaattaaagtataatattggcataattcaaaacaaattagaaaat
atgagtaaaggaaatttgcaagaaaatattgagataaaaacaaaggatgaaattgaagaa
atagcaagttttttaaatgactttagattaaaggttaatgatatgttaataaatataaaa
aatgatgtaagtactgcacaggaaagttcagatggtttatataatacagctaaggatata
gcattagcttcagagcatgttgcttcaattacgcagggagtgtcggaaaactccgtaaaa
caaacatcagatattcttagcataaaagagaacttcaatgaatttggaagggttatagat
aatactgtaaaaatagtaagtgaatttgatactatggcaaataatattaaagaaaaatct
aaggaaagcagtaaggatgtaagtttgttaataaattcaataaatgatttaaatattcac
tttaaagctgttatagagaaaattcatggattaggttctagtattgacaaaattaatgat
attacaaatttaataaatgatatatcagatcaaaccaatttacttgcgttgaatgctagc
atagaagcagcaagagctggggaatcaggcaagggattcagtgttgtagcagaggaaatt
aaggtgcttgcagaacaatctaaaatatcctctaaaaacattagtgaacttttaaaaaat
ctttcagagcaaagtaatatggttgtaattaatactaaaaatgtagattctcaattttca
aatcaaattacaattgtaaatggcattgctagttcttttggtggaataattggtgatatg
gaaaaattgctgccaggaataaatttagtcaataactctatgattgaggtaaatagtaag
aaatctataatattaagtaatttatcagattcatcttctgcttcagaggaaatttcagca
tcttcagaagagataagttctttatctgaggaattaaatggctcaacagaagaagttagt
aatgctgctgaaaaactattaggtatggttaacgatgtaatgaataacgtaaataatttt
aaaacagaaggtaaaagtttagattaa

KEGG   Clostridium carboxidivorans: Ccar_05755
Entry
Ccar_05755        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_05755
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_05755
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_05755
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_05755
SSDB
Motif
Pfam: MCPsignal 4HB_MCP_1 HAMP TarH FDX-ACB T7SS_ESX_EspC Sec34
Other DBs
NCBI-ProteinID: AKN30352
UniProt: C6PPN5
LinkDB
Position
1343559..1345259
AA seq 566 aa
MNFIKNLKIVHKISLLSASFFIFLLLLGVTSILQVSKVNYGIKQLSESRLTPIVELEKAK
SNIEYIRTKSSSLMDATDDNTRKTVEADLTTHITAVDKALEKYKSNSEYKTLLDNYDKFI
SAEEAFIKTAESGNITKQGPPTEAINLDKAKISVVASFDEIINKHVASANSTYEMSKKVF
GSTMIIIISLVAICLIITGILSLIIIKETVVPIKKVTERLKEISNNNGDLTQRIGYESKD
EIGELSSNFDMFIDKLHVIIKEIYGSANTISASSEELSMATKTTAESLDTISSTVAEIAS
STSDGAAVSEETSAHLAEVARFTEATSLATKNTTSNSKRAKRAAEDGSIKISEIVLSITD
IADSSKQVSLMISELDNSSKKIGDIIQIITGISEQTNMLALNAAIEAARAGEAGKGFTVV
ADEIRKLADESNSAAKQISDLIKENQLKSASAVSSVSKVEEKVSLGVNKASEVGQIMQNI
IENTQEIVSEVEEIDKSTETQVEGTKEMEMAINTIAANSSEIAAGTENISASIEEQLSIV
NEVERTTENLSEMSRKLKEIVSGFRV
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgaattttattaaaaacttaaaaattgtacataaaatcagtttactttctgctagtttc
tttatttttcttttattactaggtgttacttcaatattacaagtatcaaaggtcaattat
ggaattaaacagttaagtgaatcaagattgacaccaattgtagaattagaaaaagccaaa
tccaatatagagtatattagaactaaatctagttcattaatggatgcaacagatgataac
acaagaaagactgtagaagctgatcttacaactcatataactgctgtagataaagcttta
gaaaagtataaaagtaatagtgaatataaaaccttacttgataactatgataaatttata
tcagctgaggaagcttttataaaaacagctgaatctggaaatattacaaagcaaggacct
cctactgaagcaattaatctcgataaagccaaaatttctgttgtagcatcttttgatgaa
attataaataagcatgttgcatcagcaaattccacttatgaaatgagtaaaaaagttttt
ggaagtacaatgattataataatatcacttgtagctatatgtttaattataacaggaatt
ttatccttgattataattaaagaaactgttgttccaattaaaaaggttactgaaagatta
aaagaaatttccaataataatggagatttaactcaaagaataggttatgaaagtaaagat
gaaataggagagcttagttcaaattttgatatgtttattgataagctgcatgtgattatt
aaagaaatatatggttctgccaatactatttcagcttcaagtgaagaattaagcatggca
acaaagactactgcagagtcacttgatactatatcaagcactgttgcagaaatagcatcc
agcacttctgatggagcagctgtttccgaagagacttcagcccatcttgcagaagttgca
aggtttactgaagcaacttctttagcaactaaaaatactacaagtaatagtaaaagagca
aaaagagcagcagaggatggttcgattaaaatatctgaaattgttttatctataacagac
atagcagattcttctaaacaagtatctcttatgataagtgaattagataattcttcaaaa
aagataggagatattattcaaattataacaggtatatcagaacagaccaatatgctagca
ctaaatgcagcaatagaagcagcacgtgctggggaagctggaaagggctttactgtagta
gctgatgaaataagaaagcttgcagatgaaagcaattctgcagctaagcaaatatctgat
ttaataaaagaaaatcagttaaaatctgcttcagctgtaagttcagttagtaaagtagaa
gaaaaagtatctcttggagttaacaaagcttctgaagttggacaaatcatgcagaatata
atcgagaatacacaagaaattgtaagtgaggtagaagaaattgataaatctacagaaact
caagttgaaggtaccaaagaaatggaaatggctataaatactatagctgctaactcaagt
gaaatagcagcaggaactgaaaatataagtgcaagtattgaagaacaattgagtattgtg
aatgaagttgaaagaactacagagaatttatcagaaatgtcaagaaaattaaaagaaata
gtttctggatttagagtataa

KEGG   Clostridium carboxidivorans: Ccar_05795
Entry
Ccar_05795        CDS       T03979                                 

Definition
(GenBank) hypothetical protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_05795
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_05795
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_05795
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_05795
SSDB
Motif
Pfam: MCPsignal dCache_1 DUF948 dCache_2 sCache_2 GAT DUF1664 Syntaxin-6_N TACC_C
Other DBs
NCBI-ProteinID: AKN30359
LinkDB
Position
1355860..1357947
AA seq 695 aa
MKENTNLKLNIKNKLIVCFVSLTVISLLLMGTIVYWKVVIQTKNDYMNSVNKQLTEVNTG
VDNYISLIQEDTRMLAKSELLKQADSRITSYVDKKDPSGSVQMTPLTNNPYEAEVYNTFK
NFKDAHPEIQSVSLGVETNGGYVQYPASARKNGYDARTRDWYKLALANPDKAVLSDVYFS
SDGSKSIVSLSLIKDAAGTVKGAVTMNIDLDKLTKIIKGIKVGENGYIVLVDKHGTILAD
AKNPKLVSKNVKELNISKLNDSYNKDTSFEMKLQDGKKYSINVEKQSKSNLDWNYICFIE
TSEFMNSAKIIGRISFSIILIFTLLSIAITIALSRKIASPISSITEHLKLMGKGDFSNEI
NSKYLHINDEVGDIAQSTSKMQAALKEMFIKIKTHSQSIDEKAEDLYSSAQFVESSSGEV
ANAVQEVAAGTEKQAHELVEVTNILTEFGNSIQEITKTLVEIQKKSKAIDNVANESNNNM
NGLAKSVENIDGTFKKFGQKLNILGENVNKVNNIITLIDSIAEQTNLLALNAAIEAARAG
ESGKGFAVVAEEIRELAEQSKNSSNEITQLLGNISSDTKTILNDSGSMNDELNNQMTSIS
ETIKCFKEIVDKIENIIPEIDRVSYSAKNINKQKDSILMNVESTSSISQQNSASSEEIAA
SSEEMSSTAQNLFSTVEKLRDMAKDMTDEISKFKL
NT seq 2088 nt   +upstreamnt  +downstreamnt
atgaaagaaaataccaatttaaagcttaatattaaaaataaactaattgtatgttttgtt
tcactaactgtaatttcattacttttgatgggtacaattgtttattggaaggtagttata
caaacaaaaaatgattatatgaattcagtaaataaacaattaactgaagtaaatacaggg
gtagacaattatatttcattaattcaagaagatacccgtatgttagctaaaagtgaattg
cttaagcaagcagattcaagaataacttcatatgtggataaaaaagatccatcaggttca
gttcaaatgacaccacttaccaataatccttatgaggcagaagtatataatacttttaaa
aattttaaagatgcccatcctgaaatacaaagtgtttcgttaggtgttgaaacaaatgga
gggtatgtacaatatccagcttcagccagaaaaaatggctatgatgcaaggacaagagat
tggtacaagcttgcgcttgcaaatccagataaggctgttttaagtgatgtatatttttct
tcagatggctctaaaagtattgtttctctttctttaataaaagatgcggctggtacggtt
aaaggtgcagtaaccatgaatattgatcttgataagcttacaaaaatcattaaaggtatt
aaagttggagaaaatggatatattgttttagttgacaaacatggtactattttagcagat
gcaaaaaatccaaagttagtttcgaaaaacgtaaaagaattaaatataagcaaattaaat
gattcttataacaaggatacttcatttgaaatgaagcttcaagatggaaaaaaatattct
ataaatgttgaaaaacaatcaaagtcaaatttagattggaattacatatgctttatagaa
acaagtgaatttatgaatagtgctaagattataggaagaatttctttttcaattatattg
atatttacattgttaagtattgctataacaattgctttatcaagaaaaattgcaagccca
ataagcagtataactgaacatcttaaattaatgggaaaaggtgatttttctaatgaaatt
aattcaaaatatcttcatattaatgatgaagttggagacattgctcaatcaactagtaaa
atgcaagctgctttaaaagaaatgtttattaaaataaaaacgcactctcaatctattgat
gaaaaagctgaagatttatatagctctgctcaatttgtagaaagctcatctggtgaggtt
gcaaatgcagttcaagaagttgcagcaggaacagaaaagcaagctcatgaacttgtggaa
gtaactaatatacttactgagtttggaaattcaatacaggaaataacaaaaacgttagtt
gaaattcaaaaaaaatcaaaagcaattgataatgttgcaaatgaaagtaataacaatatg
aatggtttagccaaatcagttgaaaatattgatggaacctttaagaaatttggtcaaaag
cttaatattttaggtgaaaatgttaataaggtaaataatataataactttaatagatagc
attgcagaacaaacaaatctattagctttgaatgcagcaattgaagcagcaagagcaggg
gagtcaggtaaaggatttgcagtagttgctgaagaaataagagaacttgctgaacaaagt
aaaaattcctctaatgaaattacccaactgttaggcaatatatctagtgataccaaaact
attttaaatgatagtggtagtatgaatgatgaattaaataatcagatgacttctataagc
gaaacaattaagtgttttaaagaaattgtagacaaaatagaaaatataattcctgaaata
gatagagtaagctattcagctaaaaatataaacaagcaaaaagattcaattttaatgaat
gtagaaagtacttcatctatttcacaacaaaattcagcttcatctgaagaaatagcagct
tcatctgaagaaatgagttcaactgctcaaaacttattttcaactgttgagaagttaaga
gatatggctaaggatatgacagatgagataagtaagtttaaattgtaa

KEGG   Clostridium carboxidivorans: Ccar_06015
Entry
Ccar_06015        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_06015
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_06015
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_06015
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_06015
SSDB
Motif
Pfam: MCPsignal dCache_1 HAMP dCache_2 sCache_3_3 DUF1043 DUF1664 REF DUF3739 EF-G-binding_N DUF948
Other DBs
NCBI-ProteinID: AKN30398
UniProt: C6PQL2
LinkDB
Position
1396971..1398959
AA seq 662 aa
MKKVQSKLTLQIFLLVLIICGVLSFGTYYISSSSLNETVKTNLIERTDDVSKLLSNYMKN
EQTALNGLVALNEVKSGNWEIQKPILIEESKKFGFEKLGIVDLNGKAHTTLNDNELDVSK
IEYVKKALNGETGFSDATKSKVNGSLIMDAYAPIKGSDGKTIGAMIGTLDVQKVSTFLQG
MKFSNSVYPYVINKEGTVILHKDIEVVKKEDNSIKNAEKDSSYKELGNYIKKVITGETGY
GEYKYKGLEKIISYAPVSGLNWFIVVEADKSVLFNSIQHLKLMALIATIIFILVGLIFGL
FIAKSITKPLLKIRNLAERLSQYDFSNETHMLRKDEFGETAAALNTAQENIKILIKKIMD
GAQDMSAASEELSATSEELASRFEHINMSTEDIVKIAQKANSSTGNVTVSIEEIDSSIMK
LSNKAMDGSNNSNESKDRAISVQKNAKNAISESRNIYKDKEEKILKAIESAKVVGEVKTM
ADAIASISEQTNLLALNAAIEAARAGEHGKGFAVVAEEVRSLAEQTSETVYTIQDTIEKV
QEAFKNLADNGSELLKFIDENVNKQFDSYLNTGEQYYKDSEYVSGMAEDLSSMAQQITAS
VNQVTNSIQSMAEDSEKSSASTNEIKDSIQDASLAMEQIAKTAQSQAQLAQELSGIVHKF
KI
NT seq 1989 nt   +upstreamnt  +downstreamnt
atgaaaaaggttcaaagtaaattaacattacaaatttttttattggttttaataatatgt
ggagttctaagttttggaacttattatatttcatcaagttcattaaatgaaactgtaaaa
acaaacttaatagaaaggactgatgatgtttctaagcttttatcaaattatatgaaaaat
gaacaaactgcactaaatgggcttgtagctttaaatgaagtaaagtcaggaaattgggaa
attcaaaaacctatattaatagaggaaagtaaaaaatttggttttgaaaaattagggata
gtagatttaaacggaaaagcgcataccactttaaatgacaatgaactagatgtatcaaag
atagaatatgtaaaaaaagctcttaatggtgaaacaggtttttctgatgctacgaaaagt
aaagtaaacggatcactcattatggatgcatatgctccaataaaaggaagtgatggcaaa
actataggtgccatgattggaacattagatgtgcaaaaggtgagtacttttttacaagga
atgaaattttctaattcagtatatccttatgtgataaataaagaaggaacagtaatttta
cataaagatatagaggtagtaaaaaaagaggataattctattaaaaatgctgaaaaagac
tctagttataaagaactaggtaattacatcaaaaaagtaatcactggtgaaactggatat
ggagaatataaatacaaggggctagaaaaaattatttcttatgctcctgtaagtggatta
aattggtttatagtggtagaagctgataaatcagtattatttaattccatacagcactta
aaattaatggcactcattgctaccataatttttatattggtaggattaatttttggatta
tttatagctaaatccataacaaagcctttactaaaaattagaaatttagcagaaaggctt
tcacaatatgatttttcaaatgaaacgcacatgttaagaaaagatgaatttggagaaact
gcagcagctcttaatactgctcaggaaaatataaaaatattaattaaaaagattatggac
ggagcacaggatatgagcgctgctagtgaagaattatctgcaacttctgaagaacttgct
tcaagatttgaacatataaatatgtcaactgaagatatagtaaaaatagcccaaaaagct
aactcatcaacaggaaatgttacagtttctatagaagaaatagattccagtataatgaaa
ctttcaaataaagcaatggatggaagtaataattcaaatgaatctaaagatagagctatt
tcagtacaaaaaaatgctaagaatgctatatctgaaagtagaaatatttataaagataaa
gaggaaaagattttaaaagctatagaatcagcaaaagttgtaggagaagtaaagacaatg
gcagatgcaatagcaagcatttctgagcaaactaatctattagcattgaatgcagcaata
gaagcagcaagagcaggagagcatggtaaaggttttgctgtagttgctgaagaggtaaga
agtttagctgaacaaacttcagaaaccgtttatacgatacaggatactatagaaaaggta
caagaagcatttaaaaatcttgctgataatggcagtgagttgttaaaatttattgatgaa
aatgtaaataaacaatttgactcatatttaaatacaggagaacaatattataaggattca
gaatatgtgtcaggaatggctgaggatttatcatccatggctcagcagattacagcatca
gtaaatcaggtaaccaattcaattcaaagtatggcagaggattcagaaaaatcatctgca
agtacaaatgaaataaaagatagtatacaggatgcatcacttgctatggaacagatagct
aaaacagcacaaagtcaagctcaattagcacaggaacttagtggaatagttcataaattt
aaaatataa

KEGG   Clostridium carboxidivorans: Ccar_06875
Entry
Ccar_06875        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_06875
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_06875
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_06875
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_06875
SSDB
Motif
Pfam: MCPsignal 4HB_MCP_1 HAMP TarH Laminin_I Glyco_hydro_63 DUF1664 Alanine_zipper ParB AI-2E_transport T7SS_ESX_EspC DUF4064
Other DBs
NCBI-ProteinID: AKN30562
UniProt: C6PUD5
LinkDB
Position
1592111..1593823
AA seq 570 aa
MKWFNNLKIWQKIASLSVFISIFIIIVGVVGAANIKKIGINSNEMYSDNFIGINAIRTIK
DNQTQIRADLLLLVYKRDRSELEDIKKEISDLEKETSNALNTYKEGSTTSDDTKMYTELE
KSIADYKETRDQLIKLVDEQKYDEAVKFFPKVGTAREKVSKQIENMIKSNEKMAKEKDVS
NGQTTVSSLRTIGFVSVLALIIAIALGGIIANIMSKQLKQILKFGEAFGEGDLTQQIDID
TKDEIGNLAKALNTAGENIKNLISQINNSASDISASSEELSATTEEVSANTQNVTQSTEQ
IAKGNENLGAVIEQVDASVQEINSTTIELSNKADKAALSVREIKSRAFEVKDKAKKDIEN
GSKIYDEKYNNIIKAIEEGKVVGKVREMAESIADISEQTNLLALNAAIEAARAGEQGKGF
AVVAEEVRELSEQSAGAVTQIQNMVAQIQSAFNNLSNSAKDILDYVNDSVKPSYELLLKT
GIAYEKDSEFINNMSEEIALATKKMSETVGQVTRAIDNVASTAQTSAAGSEEILSSIGEV
STAIEDVARSAQTQSDLAQKLNEMVMKFRV
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgaaatggtttaacaatttaaaaatatggcaaaaaatagcgagtttatctgtctttata
tcaatatttataataatagtaggtgtagttggagctgctaacataaaaaagataggaatt
aactccaatgaaatgtattctgataactttattggaataaatgctattaggaccataaaa
gataatcagacacaaattagagcagatttgcttttacttgtatacaaaagagatagaagt
gaacttgaagatataaaaaaagagatatctgatttggaaaaggaaactagtaatgcacta
aatacatataaggaaggttctactacaagtgatgatacaaagatgtatacagaacttgaa
aagtcaatagctgactataaagaaactcgtgaccaacttataaaacttgtagatgaacaa
aaatatgacgaagctgttaagttcttccctaaggttggaactgctagggaaaaagtaagt
aaacaaattgagaatatgattaaatcaaacgaaaaaatggcgaaagaaaaagatgttagt
aatggacaaacaacagttagctctttaagaactattggatttgtaagtgttttagcatta
attattgctatagcgctaggtggaataatagctaatataatgtctaaacaattgaagcaa
atattaaaatttggagaagcctttggagaaggagatttgacacagcaaattgatattgat
actaaagatgaaataggaaatcttgctaaagctttaaatactgcaggagaaaatataaag
aatttaatttctcaaattaataatagtgcatcggatataagtgcttccagtgaggaatta
tcagcaacaacagaggaagtttctgctaatacccaaaatgtaactcaatcaactgaacaa
attgcaaagggaaatgaaaatttgggtgctgtaatagaacaggtagatgcttctgtacag
gaaataaattcaactacaattgaattatcaaataaagctgataaagcagctttatctgta
agagaaataaaatcccgagcatttgaggtaaaagataaagctaaaaaagatatagaaaat
ggaagtaaaatttacgatgaaaaatataataatataataaaagctatagaagaaggaaaa
gtagtaggtaaagtaagagaaatggctgagtccatagcagatatatcagaacaaacaaat
ttattggctttaaatgcagctatagaggcagcaagggctggtgaacaaggaaaagggttt
gctgtagtagctgaagaagtaagagagctttcagaacaatctgcaggtgctgttacacaa
attcagaatatggtagcacaaattcagagtgcatttaataatttatccaacagtgcaaaa
gatatattggattatgtaaatgatagtgtaaagccaagttatgaattattgctaaaaact
ggtatagcctatgaaaaggattctgaatttattaataacatgtcagaagaaatagcttta
gcaacaaaaaaaatgagtgaaacagtaggtcaagtaacaagagctattgataatgtagct
tcaactgcacaaacatctgcagcaggctctgaagaaatattaagcagtataggtgaagta
tcaactgcaatagaagacgttgcaagatcagcacaaactcaatctgaccttgcacaaaag
cttaatgaaatggtaatgaaatttagagtatag

KEGG   Clostridium carboxidivorans: Ccar_07045
Entry
Ccar_07045        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_07045
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_07045
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_07045
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_07045
SSDB
Motif
Pfam: 4HB_MCP_1 MCPsignal TarH Laminin_II DUF1664 UPF0242 TMPIT T3SSipB
Other DBs
NCBI-ProteinID: AKN30596
LinkDB
Position
1628987..1630699
AA seq 570 aa
MNLLKNVKVKVKLILAFLIINLLIVAIGFSSSKDLSIVGTNSDNMYNNSLQSVYMLTDIK
QNLTRVEYDLMRLIYVKDASEKASLKKELQSEVDENNGYIAKYEKLSMNKSEKQNWPKFK
SDLDQWRTLRAGVVKYIDENKFQEASSELEKLNPIGKDLFQNLDTVINSNLKDANEANAN
NHSIFIAANRNIIIFTLIGLGLAVILGFIMSKDINSALSKMMNLSESLAEYDLSNEFKQT
RNDEFGEAFGLLLKAQSNIKELVTTIMNNTEDISNSSVNLSVTVEEITSKFENINNATKR
IANGVQETSASSEEVSASIEEVNSNINELSAKAVEGSNNASEFKDRASDIRKKGSASIDE
TNRLYEQKEERILNAIEAGKVVENIRFMADTIGSIAEQTNLLALNAAIEAARAGENGKGF
AVVAEEVRTLAEQSAESVVGIQDTILKVQEAFKNLSGNSSEILKFINEDVNVQFKAFGEM
GNQYYNDSDFVSKMSEEIASMTEEINATVGQVSYAVNSMAVNAQESSENIAAIEDSINEA
AKGINKVEKTAQGQAELAKKLNSMVQKFKI
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgaatttattgaaaaatgtaaaagtaaaagtaaaactaattttagcctttttaataata
aacctgcttatagtagcaataggttttagcagttctaaagatttatcaattgtaggaaca
aattctgataatatgtataataatagtttgcaaagtgtttatatgcttactgatataaag
caaaatttaaccagagttgaatatgatttaatgagactaatttatgtgaaagatgcttca
gaaaaagctagtttaaaaaaagaattgcaatcagaagtagatgaaaataatggatatata
gcaaaatatgaaaaactttctatgaataaatcagaaaaacaaaattggcctaaatttaaa
agtgatttagaccagtggagaactttaagagctggtgtggttaaatatatagatgaaaat
aaatttcaggaagcttcaagtgagcttgaaaaattgaatcctattggtaaagatttgttt
caaaatttagatacagttataaattccaatttgaaggatgcaaatgaagctaatgcaaat
aatcattcaatatttattgcagccaatagaaatattattatatttaccttgattggatta
ggcctagctgtaatacttggatttattatgtcaaaggatataaatagtgccttatcaaag
atgatgaatttatcagaaagtttggctgaatatgatttgtctaatgaatttaaacaaact
agaaatgatgaatttggagaagcttttggattacttctcaaagctcaaagtaatattaag
gaactagtaactacaattatgaataatactgaggatattagtaattctagtgtaaatctt
tcagttacagttgaagaaataacctcaaaatttgaaaatattaataatgcaacaaaacgt
atagcaaatggtgtgcaggaaacaagtgcatcttctgaggaagtcagtgcttctatagaa
gaagttaattccaatattaatgagttatctgctaaagctgtggaaggaagtaacaatgca
agtgaatttaaagatagagcttctgatataagaaaaaagggcagtgcatctatagatgaa
acaaacagattatatgaacagaaggaagaaaggatacttaatgccatagaagcaggtaaa
gtagtagaaaatataagattcatggcagatactattggcagtatagcagagcagacaaac
ttacttgctttaaatgcagctatagaagcagcacgagcaggagaaaatggtaagggtttt
gcagtagttgctgaagaagtaagaactcttgcagaacaatcagctgagtcagtagtaggt
attcaagataccattttaaaagttcaagaagcatttaaaaatctttctggaaatagtagt
gaaattttaaaatttataaatgaagatgtaaatgtccaatttaaagcttttggagaaatg
ggtaatcaatattataacgattcagattttgttagcaaaatgtcagaagaaatagcatct
atgacagaagaaattaatgctactgtaggtcaagtaagttatgcagtaaatagcatggct
gtaaatgcacaagaatcttctgaaaatatagctgctatagaagacagtattaatgaagct
gctaaaggtattaacaaggtagaaaaaacagctcagggacaagctgaacttgctaagaag
cttaatagtatggtacagaaatttaaaatatga

KEGG   Clostridium carboxidivorans: Ccar_07830
Entry
Ccar_07830        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_07830
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_07830
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_07830
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_07830
SSDB
Motif
Pfam: MCPsignal HAMP 4HB_MCP_1 Crescentin DUF948 TarH DUF1201 DUF5798
Other DBs
NCBI-ProteinID: AKN30750
UniProt: C6Q1N2
LinkDB
Position
complement(1803351..1805039)
AA seq 562 aa
MNLKIRSKLILAFGVILVCFLLNIVISISFLNNNDKSISKVRNFTYKQLKYSSNINVSVI
EVQQFLSDASATKNMDSLKEAEKCKATFKDSLKQLESINPNIKSETEKIDKDFDKFYELG
VNMANVYIKEGPDKGNVLMTQFDPMATNLSNEINSLNDNAEASMNSDLQNIQSTMTRNKV
FSIVLGSFSLILAVIVIILLQGSILKPINSMFAILKDIENGQGDLSKRIKIKSDDEIGIM
AKSFNNFMDQLVSMIENIKENSILVSKSSEVLNEGAEKSIESIRQINENMIELDNGSENI
SSSVSEVAASSSNIAESTQITAEEVENISIMTEEINNIAMESGKFVKSTREEMNKIESIS
SANMVINEKLGAKAEEIRNIIDTIKSISDQTNLLALNASIEASRAGEHGKGFAVVADEIR
ELSENNNESSKSIENIIEGINEMIKNTIDSAAQEASNIKKGNKMVEEVVIQIEKIIEGIN
NINSKIQSIAASAQEQSASIEELTSTMEAVSNSNAEMSAEIKSVSNGVQSQADIISEFAE
MAENLSNSSNQLNNLVNKFKIK
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgaatttgaaaataagatcaaaattaattttggcatttggagtaattttagtatgcttt
ttgcttaatattgtaatcagtatcagtttccttaataataatgataaaagtataagtaaa
gtaagaaattttacatataaacaattaaaatattcatctaatataaatgtttcagtaatt
gaggttcagcaatttttatcagatgcttctgctactaaaaacatggacagccttaaagag
gctgaaaaatgtaaggcaactttcaaagattcattaaagcagcttgaaagcataaatccc
aatattaaaagtgaaactgaaaagatagataaagattttgataaattttacgaacttgga
gtaaacatggcaaatgtttatataaaggaaggtcctgacaagggtaatgtattaatgact
caatttgatcctatggcaactaatttgtctaatgaaattaattcattaaatgataatgct
gaagcttccatgaattcagatttacaaaacatacaaagcactatgactaggaacaaagta
ttttcaatagtattaggaagtttttctttaattctagcagttatagttataatattgtta
caaggtagtattttaaagccaattaacagtatgtttgctatacttaaggatatagaaaat
ggacaaggagatttaagtaaaagaataaaaataaaatctgatgatgaaataggtataatg
gctaaatcctttaataattttatggatcaactagttagcatgatagaaaatataaaagaa
aattctattcttgtatcaaaaagctctgaagtactaaatgaaggagctgaaaaaagtata
gaaagtataaggcaaataaatgaaaatatgattgaattggataatggaagtgaaaatatt
tctagttcagtaagtgaagttgctgcaagttcttctaatattgcagaatcaacacaaatt
acagctgaagaggttgaaaatataagcataatgacagaagaaattaataatattgctatg
gaaagtggtaaatttgtaaagagcactagagaagaaatgaataaaattgaaagcatctcc
tcagccaatatggttataaatgaaaaattaggagctaaagcagaagaaattagaaatata
attgatactattaagtcaatatcagatcaaactaacttgctagctttaaatgcttctata
gaagctagcagagcaggagaacatggcaaaggttttgcagtagtggctgatgaaataagg
gagctttctgaaaataacaatgaatcctctaagagcattgaaaatataatagagggtata
aatgaaatgataaaaaatacaatagattcggcagcacaagaagcatctaatataaaaaag
ggaaacaaaatggttgaagaggtagttatacagattgaaaagattatagaaggaataaat
aatataaacagtaaaattcaaagtatagcggcatcggcacaagagcaaagtgcttcaatt
gaagagcttacatctactatggaagctgtaagtaatagtaatgcagaaatgtcagctgag
ataaagtctgtatctaatggtgttcaatcacaagctgatataatatcagaatttgcggaa
atggccgaaaatctaagcaattcatcaaatcaattgaataatttagtgaataagtttaaa
attaagtaa

KEGG   Clostridium carboxidivorans: Ccar_07955
Entry
Ccar_07955        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_07955
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_07955
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_07955
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_07955
SSDB
Motif
Pfam: MCPsignal Cache_3-Cache_2 sCache_3_3 sCache_3_2 UPF0242 HAMP MtrC
Other DBs
NCBI-ProteinID: AKN30774
UniProt: C6Q1A7
LinkDB
Position
complement(1836855..1838561)
AA seq 568 aa
MSKLGAKIFKLVSFVSGIIVVISLISYFIIFKNVEMQLKDKAKQSVTESINVIDKDKVEK
IIKDKSNKSKEYSEVLNSMITFKAKKDIKNFYVYVKKDDKTAQFLLDASPEPADYMEDYE
MVDEMKTAFDGKIVVDNEPCTDKWGTYVSAYAPIKDSSGQVIASIGVDEDISTFQNIKKS
FLIISILEIAVAIIISLVSVWLFSKKLKYSINIIESKLMNMSEGDLQGEIQLKTKDEIAQ
IANCLNNFRLKISDILISIKHNVCNVHEDSKGLYTISEEMSSSAENVSLIVGNISENSAE
QASDIFNIKENFNEFGKSIENTAKMMGEFDIMAIDIKEKSKESNSKLSLLTNSINDLNIK
FKSVAEKIQNLGSNIDKINDITNLINDISDQTNLLALNASIEASRAGEAGRGFSVVADEI
RTLAEQSKMSSQNISELLKNVSKQSSNVVIDTKNVDSQFSSQMGIINSIASSFGEIISDI
ERLLPGINLVNKSIIEANNKKSIIINSLENSSSSAEEISTSSREIVVLAEELSSSTEEVA
NASEKLLHMVDNVMNNVNKFKTLKENER
NT seq 1707 nt   +upstreamnt  +downstreamnt
atgagtaaacttggtgctaaaatttttaaattagttagttttgtatctggtataattgta
gtaatatccttgataagttattttattatatttaaaaatgtagaaatgcaattgaaagat
aaagcaaaacagtctgttactgagtcaattaatgttattgacaaagataaagtggagaaa
ataattaaagataagtctaataaatctaaagaatattctgaagtgctgaattctatgata
acgtttaaggctaaaaaagatataaagaacttttatgtctatgtaaaaaaagatgataaa
actgcacaatttcttttggatgcttcaccagagccagctgattacatggaagattatgaa
atggtggatgaaatgaaaactgcttttgatggtaaaattgttgttgataatgaaccatgc
acagataaatggggaacttatgtgtcagcgtatgctccaataaaagattcatctggacaa
gttatagctagtattggtgtagatgaagatatttctacatttcaaaatatcaagaagtca
tttcttattatatcaattttagaaattgcagttgccattattatatctttagtttctgta
tggttgttttcaaaaaaattaaaatatagtattaatataattgaaagtaaattgatgaat
atgagtgaaggagacctacaaggggaaattcagttgaaaacaaaggatgaaattgcacaa
atagcaaactgcttaaataattttagattgaagattagcgatattttaataagtataaaa
cataatgtgtgcaatgttcatgaggattctaaaggtctatataccatatctgaggaaatg
tcatcgtcagcagaaaatgtttctttaatagtaggaaatatatctgaaaattctgcagag
caggcttctgacattttcaatataaaagaaaactttaacgaatttggtaaaagtatagaa
aatactgccaaaatgatgggcgaatttgatataatggcaattgatattaaagagaaatct
aaagaaagtaatagtaaattaagcttattgacaaattcaataaatgatttaaatattaaa
tttaaatctgtagctgaaaaaattcaaaatttaggttctaatattgataaaataaatgat
attacaaatttaataaatgatatatcagatcaaactaacttacttgcattaaatgcctct
atagaagcatctagagcaggagaagctggaagaggatttagtgttgtagcagatgaaatt
agaactcttgcagaacaatcaaaaatgtcctcgcagaatattagtgaacttttaaaaaat
gtttctaaacaaagtagtaatgttgtaattgacactaaaaatgtggattctcaattttca
agtcaaatgggtattataaatagtattgccagctcttttggtgaaataattagtgatatt
gaaagattgttaccaggaataaatttagttaataaatctattattgaagctaataataaa
aaatctataataataaatagtttggaaaattcatcttcttctgcagaagaaatttctaca
tcctctagagaaatagttgttttagctgaagaattaagcagttctactgaggaagttgca
aatgcttctgaaaaattgctgcatatggttgataatgtaatgaataatgtaaataagttc
aaaacattaaaagaaaatgaaagataa

KEGG   Clostridium carboxidivorans: Ccar_08410
Entry
Ccar_08410        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_08410
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_08410
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_08410
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_08410
SSDB
Motif
Pfam: MCPsignal 4HB_MCP_1 TarH HAMP JIP_LZII BacA Psg1 XS FtsX
Other DBs
NCBI-ProteinID: AKN30860
UniProt: C6PN36
LinkDB
Position
complement(1955042..1956730)
AA seq 562 aa
MKWFYNLKIKAKIIFYFVMLVIFIGVVGIIGITNMKNINSRSEDMYKNNLLEIQNAQNMQ
KDLFIIRSDYLSMLYEKDNSKLQQRINDIQKLIEECNQIQKDYEPTIESSEERNLFNSLK
NNFTTYKNTLDEHINLMKAGNYLEVSSKVSQLVSLREKSDQSIQDLISLNKKNAETKNSI
NIASYKNQSIIMIIVIIVGAILAVVIGLLFANMISKPLNQIVNAANSIAKGDLDVYVNVD
TKDEIGILADAFMKMSININEAMSNINAAAEEVAAGAKQASDSSIALSQGSTEQASSIEQ
LTASMEEISSQTSENSNSASKANELASATKENAIKGNEHMKEMLKSMEDINESSSNISKI
IKVIDEIAFQTNILALNAAVEAARAGQHGKGFAVVAEEVRNLAERSANAAKETTNMIEGS
IKKVESGTKIASETASALSEIVKDVAEVADIVKGIAQASNEQALGIEQINQGIMQVSNVV
QTNSATSEEIAAASEELYGQAEMLKEEVERFKLKKTDNYHGKIEKLSPEVLEFLKKMNGN
KKYNKNNSPRIALTDKELELDQ
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgaaatggttttacaatttaaaaataaaagctaagattattttctattttgttatgctt
gtaattttcattggagtagttggaattattggtattaccaatatgaagaacattaacagc
agaagtgaagacatgtataaaaacaatttgctcgagatacagaatgctcaaaatatgcag
aaagatttatttattatccgttcagattatttgtcaatgttgtatgaaaaagataactcc
aagttacaacaaaggataaatgatattcaaaagttaatagaggaatgtaatcaaatacaa
aaagattatgagccaactattgaatcttcagaggaaagaaatttattcaattctttaaaa
aataattttaccacatataaaaatacattagatgaacatataaacttaatgaaggcaggc
aactatttagaagtaagttctaaagtgagtcaacttgtaagtttaagagaaaaaagcgat
caatcaattcaagatttgataagtttaaataagaaaaatgcagaaacaaaaaactcaata
aatattgcaagttataaaaatcaatctataattatgattatagttataatagtgggagct
atacttgcagtggttataggtttattatttgccaatatgataagtaaacctttaaatcaa
attgtaaatgctgctaatagtatagccaaaggagacttggatgtatatgtaaatgtagat
actaaggatgaaataggtatattagcagatgcttttatgaaaatgtcaattaatattaat
gaagccatgtcaaatataaatgctgcagcagaggaagtagcagcgggagcaaagcaagca
tctgattcaagtattgcactttctcaaggaagtactgaacaagcaagttcaattgaacag
ctaactgcttccatggaagaaatatcatcgcaaacaagtgaaaatagtaatagtgcaagt
aaagccaatgaacttgcgtctgctacaaaagaaaatgcaattaaaggtaatgaacacatg
aaggaaatgttaaagtccatggaagatattaatgaatcatcttcaaatatttcaaagatt
attaaggttatagatgaaattgcattccaaactaatatacttgctcttaatgccgcagtt
gaagctgcaagagctggacagcatgggaaaggttttgcagtagttgcagaagaagtgaga
aatttagctgaacgttctgctaatgcagctaaagaaactacaaatatgattgaaggttcc
attaaaaaggttgaaagtggtactaaaatagcatctgaaacagcatcggcattaagcgaa
atagttaaagatgttgcagaagtagcagatattgttaaaggtatagctcaagcatcaaat
gagcaagcattgggtattgaacaaattaatcaaggaattatgcaggtatctaatgtggtt
caaacaaattctgcaacttctgaagaaattgcagcagcaagtgaagaactttatggtcaa
gctgaaatgttaaaagaagaagttgaaagatttaaattgaagaaaacagataattatcat
ggtaaaatagaaaaacttagtcctgaagtattagaatttttaaaaaaaatgaatggaaat
aaaaaatataacaaaaataattcacctagaattgctttaaccgacaaagaattggagcta
gatcaatga

KEGG   Clostridium carboxidivorans: Ccar_08420
Entry
Ccar_08420        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_08420
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_08420
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_08420
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_08420
SSDB
Motif
Pfam: MCPsignal dCache_1 DUF1664 UPF0242 DUF1993 DUF1240
Other DBs
NCBI-ProteinID: AKN30862
UniProt: C6PN34
LinkDB
Position
1958574..1960568
AA seq 664 aa
MKSIRSKLILAISSTCIILILISSIVSYAISYKTITKQSSEQALIASEKYSELINGWLDG
QAKILDETDYAIENLGNFDENGISNYLQSKLKLNSNITDIYIGMTNKKMIDGSGWNPPAD
YDCTQRSWYKLAMEKKSLIYTPPFLDQTTKKMVVSIAKPVTKNGQVIGVISTDINLDLLT
DTIKKASPINNSYSYLMDSSNNIIIHPNKDFQPKDKELKNLSNVFDGKYMSITSKNSFVL
KDYDGTNRYFVSSKVKASNWIIGFAIPTKEFNKPLNALVIYAVIILIASLIFSLIFASYL
SSKLAGPISLITKDINKLKDFDFENDDDECNKALKYKDEIGIIAHSVLNLKQELRKIVED
LKNSSDSILKYSNNVSSSVEQTVMSITDVAKATSQLAEGSVEQAKESETGLKKLNNLADK
INTIVLKTNEVKKYSYLTNDVNKKGMSSILDLSSKLEQNNDASQKVAENINILSKKSESI
GAIVNTIESIAEQTNLLALNAAIEAARAGESGKGFAVVADEVRNLSEETAASTKEISNMI
KEILDEINSTQLNMVNAEKIIKEANNSMAESEKSFKTIEDSINKMITYIEELTSEIDEVE
ENKEIAVKSIEGISVISEEAAASTEEVSASMEEQSSAMEIISSNMEELKNITNSLNEIVA
KFKL
NT seq 1995 nt   +upstreamnt  +downstreamnt
atgaaaagtataagatcaaaactaattctagcaatttcttcaacctgtattatacttatt
ttgatttcctctatagtaagctatgctatatcatataagaccattaccaaacaatcaagc
gaacaagcattaattgcttctgaaaagtattcagaattaatcaacggatggcttgatgga
caagcaaaaatacttgacgaaactgattatgcaatagaaaatctaggtaattttgatgaa
aacggtatatcaaattatcttcaatctaaattaaaattgaattctaatattactgatatt
tatattggaatgacaaacaaaaaaatgatagatggttctggttggaatcctcctgcagat
tatgattgtactcaaagaagctggtacaaattagccatggaaaagaaaagtctaatttac
acaccacccttcttggatcaaactacaaaaaaaatggtagtttctatagctaaacccgtg
acgaaaaatggacaagtaataggtgttattagtacagatattaatttagatctccttaca
gatacaataaaaaaagcttcacctataaataatagttattcttacttaatggattcaagc
aataatattattattcatccaaataaggattttcaacctaaagataaagagcttaaaaat
ttaagtaatgtatttgatggtaaatatatgtcaattacttctaaaaactcctttgtctta
aaagattatgatggtacaaatagatattttgtgtcatcaaaggtaaaagcttcaaattgg
attataggatttgctatacctactaaagaatttaacaaacctctaaatgctttagttata
tatgctgttatcatattaatagcgtctttaattttttctttaatatttgcttcatatctc
agcagcaaattagctggccctatatccttaataacaaaggatatcaataaattaaaggat
tttgattttgaaaatgatgatgatgaatgcaataaggcattaaaatataaagatgaaata
ggcattattgctcattctgtattaaatttaaaacaagaattaagaaaaattgttgaagat
ttaaaaaatagttcagatagcatattaaaatactcaaacaatgtgtcctcttctgtagaa
caaacagttatgtctattacagatgtagctaaagctacaagccaattagcagaaggttca
gttgaacaagctaaagaatcagaaacaggacttaaaaagttaaataacttagcagacaaa
ataaatactatagtattaaaaactaatgaagtaaaaaaatattcatatttaactaatgat
gttaataaaaaaggtatgtcttccattttagatttatcttctaaattggaacaaaataat
gatgctagccaaaaagtagctgaaaatattaatattttatctaaaaaatccgaatctatt
ggtgctatagtaaataccatagaatccatagctgaacaaacaaatttgttagctttaaac
gctgctattgaagctgcaagagctggagaatctggaaaaggatttgcagttgttgcagat
gaagttagaaatttatctgaagaaacagctgcttctacaaaagaaatttctaatatgata
aaggaaattttagacgaaatcaattcaactcaattaaacatggtaaatgctgaaaaaata
atcaaagaagctaataattctatggctgaatctgaaaagtcgtttaaaacaattgaagat
tcaataaacaaaatgataacatacattgaagaacttacatctgaaattgatgaagttgaa
gaaaataaagaaattgccgttaaatccattgaaggtatatccgtaatatctgaagaagct
gctgcttctactgaagaagtttcagcttctatggaagaacaatctagtgctatggaaatt
atatcttctaatatggaagaactaaaaaatattacaaatagtttaaatgaaatagttgct
aagtttaaactataa

KEGG   Clostridium carboxidivorans: Ccar_08425
Entry
Ccar_08425        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_08425
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_08425
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_08425
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_08425
SSDB
Motif
Pfam: 4HB_MCP_1 MCPsignal TarH HAMP DUF4064 Collagen_mid DUF1664 FtsX DUF4200 Cytadhesin_P30 DUF2207 Crescentin DUF2970 FKS1_dom1 DUF948 KIX_2 LMBR1 DUF3566 CoV_S2
Other DBs
NCBI-ProteinID: AKN30863
UniProt: C6PN33
LinkDB
Position
complement(1960618..1962330)
AA seq 570 aa
MQWFKNLKMVQKLISAFVVVALFIGVVGFIGVYNMKSIYSNANSMHDYNLKSIETLMIMK
ENYADVRSDLLKIVYQQDLSDKNSIKKEITDLSAKNDTSIDTYEKTLLSKDEESIFSQLK
KDRSTYKEAFTAVIKLIDENNYKGAQEKFSDVTKSRTKIYEDMDNLIKVNSDQADKADAQ
NKSTYESSFIITTIIGVVGLVLAIIIGLFIALMISKEINKVLVFAEALGEGDLSKSIEVD
RKDEIGNLGKALNKACENVKELISSIIDSAGDISSSSEELSATTEEITSMMEAANESTEQ
ISQGAQELSSTTEGVNTSMQDISISTSELLNRSIDAKNSSEEISKRAIDIKDKAAKNIKE
GGLIYKEKKSNIIKSIEDGKVVEEVKIMADSIGSIAEQTNLLALNAAIEAARAGEQGKGF
AVVADEVRDLAEQSSQAVTNIQNMVSQVRNAFDSLSKSGQDILHYMENIVKPSYELLMNT
GVQYEKDSDYVRDMSEKISTLSNKMNDAAGNISDSIQNISATSQESAAGSEEVTSSISEI
TKAVSEVSKSAQSQAELAQKLNEMVQKFKI
NT seq 1713 nt   +upstreamnt  +downstreamnt
gtgcagtggtttaaaaatttaaaaatggtacaaaaattaatatcggcatttgttgtagta
gcattatttattggtgtagttggatttattggagtatataatatgaaatcaatatattct
aatgctaactctatgcatgattataatcttaagtcaatagaaacgttgatgattatgaaa
gaaaattatgcagatgttcgctcagatttgttaaaaattgtatatcaacaggacttgagt
gataagaacagcataaaaaaagaaattactgatttaagtgccaaaaatgatacaagtata
gatacttatgagaaaacattgttgtctaaagatgaagaatcaattttttcacagttaaaa
aaggataggagtacatataaagaagcatttactgctgtaataaaacttattgatgaaaat
aattataaaggtgcacaagaaaaattttctgatgttactaaatcaagaacaaaaatttat
gaagatatggataatctaataaaagtaaattctgatcaagcagataaggcagatgctcag
aataaaagtacatatgaatcatcttttattattacaactattataggtgtggtaggatta
gtacttgcaattataattggcttgtttatagcacttatgatttcaaaggaaataaataaa
gttttagtttttgcagaagctctaggagaaggagatttaagtaaatctatagaagtggat
agaaaagatgaaataggtaatttaggtaaggctttaaataaagcttgtgaaaatgtgaaa
gaattaataagttcaataatagatagtgcaggagacataagttcttccagcgaggaatta
tctgcaacaactgaggaaattacatctatgatggaggctgcaaatgaatcaactgaacaa
atttcacaaggagctcaagagttgagctcaacaaccgaaggcgtaaatacatctatgcag
gatatttctatatcaactagtgaattactaaacaggtcaatagatgctaagaattcttca
gaggaaataagcaaacgtgcaattgatataaaagataaagcagctaaaaacataaaagag
ggaggcttaatatataaggaaaagaaaagtaatattataaaatcaattgaggacggtaag
gtggttgaagaagttaaaattatggctgattccattggaagtatagcagagcaaacaaac
cttcttgcgttaaatgctgcaatagaagcagcaagagctggtgaacaaggaaagggattt
gcagtggttgctgatgaagttagagatttggcagaacaatcttctcaagctgtgacgaat
attcaaaatatggtatctcaagtaaggaatgcatttgacagtttatcaaaaagtggacaa
gacatattacactatatggaaaatattgttaaacctagctatgaattacttatgaataca
ggtgtgcagtatgaaaaagattctgattatgtaagagatatgtctgaaaaaatttcaact
ttatcaaacaaaatgaatgatgctgcaggcaatataagtgattcaattcaaaatatatca
gcaacttcacaggaatcagcagctggttcggaagaagttacaagcagtataagtgaaata
acaaaagctgtaagtgaggtttctaagtctgctcagagtcaagctgaacttgcgcagaag
cttaatgaaatggttcaaaaatttaaaatataa

KEGG   Clostridium carboxidivorans: Ccar_08565
Entry
Ccar_08565        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_08565
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_08565
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_08565
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_08565
SSDB
Motif
Pfam: MCPsignal Ferritin CK2S Laminin_II DUF948 Noelin-1 Sec34 CP12 Urocanase LOH1CR12
Other DBs
NCBI-ProteinID: AKN30891
UniProt: C6PN02
LinkDB
Position
complement(1995728..1996690)
AA seq 320 aa
MLKLNIKDKKQENKESVDMKQENSMQCFKYANEVNELTNEVDKNIQDLLKKEGSITYGLN
ELLEGTEYTTNQTEKVNDYLDSLSQNSEKTTKLVDEVFESLKDSLKEIDGAKNDFYDLIN
QVNSVSKVFEEFFKLFVELQSHYKNIEGFASIITNIANQTNLLSLNAAIEAARAGEAGKG
FSVVANEMKKMSIDTQKNAKYIMETLKEMTETIELINNKSNEGGKTISKTESIIKNSKNL
LDNIINSESKVCKHVEVVKDSQEQNLGGIQQIASTLTNIVNKSKKENEELEELTLDIQKK
ADSYMHILNGINQIKLLHDK
NT seq 963 nt   +upstreamnt  +downstreamnt
atgttaaaattgaatataaaagataaaaagcaagaaaataaagaatctgtagatatgaaa
caagaaaattccatgcaatgttttaaatatgcaaatgaagttaatgagttaactaatgaa
gttgataaaaatatacaggatttattgaagaaagaaggaagcataacatatggacttaat
gaattgcttgaagggacagagtacactactaatcaaactgaaaaggtaaatgattatcta
gattctttatctcaaaatagtgaaaaaacaacaaagcttgtagatgaagtatttgaaagt
ttaaaagattcattaaaagaaatagatggtgctaaaaatgatttttatgatttaataaat
caagttaatagtgtttcaaaggtttttgaggaattttttaaattgtttgtagaattacaa
tctcattataaaaatatagaaggttttgcatccataattacaaatattgcaaatcaaact
aacttattatcactaaatgctgctattgaagcagcaagagccggtgaagctggaaaagga
ttttctgtggttgcaaatgaaatgaaaaaaatgtccatagatactcaaaaaaatgcaaag
tacattatggaaactttgaaagaaatgactgaaactatagagcttataaataataagtct
aatgaaggcgggaagactatatcaaaaaccgaaagcatcataaaaaattctaaaaatctt
ttagataatataattaattcggaatctaaagtatgcaagcatgtggaagtagtaaaggat
tctcaagaacaaaatttaggtggaattcaacaaatagcatctactttaactaatattgta
aacaaatctaaaaaagaaaatgaagaacttgaggaattgacattagatatacaaaagaaa
gcggattcttatatgcatatattaaatggaattaatcaaattaaattacttcatgataag
taa

KEGG   Clostridium carboxidivorans: Ccar_08660
Entry
Ccar_08660        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_08660
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_08660
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_08660
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_08660
SSDB
Motif
Pfam: MCPsignal DUF948 Laminin_II Baculo_PEP_C RmuC DUF745 DUF1664 CheZ EzrA Sec34 Fzo_mitofusin Filament TMPIT Transcrip_act Syntaxin-6_N Dor1 GOLGA2L5 T7SS_ESX_EspC Latarcin SKA2 CALCOCO1 Fib_alpha Mating_N Laminin_I TPR_MLP1_2 Mce4_CUP1
Other DBs
NCBI-ProteinID: AKN30908
UniProt: C6PMY2
LinkDB
Position
complement(2014990..2015982)
AA seq 330 aa
MLELFRKNKKIDVEVSSSDNNEKEIKSIDDISEQQCINYSLSYIQERMSNLMDSEINISK
TVNDVSRTFNQVSGSIDKIGNVLDNFNDNFNHFAESSSNIDTATDDSIKALDNANIMMAD
LKSKMHNIEKSMNEFANTFFILKSSFKDIGKLSNSISDVANETNLLALNANIEAARAGEA
GKGFAVVAEEVRKLADSTKELVDGINKKMAEMDNNVENLSSSVEYSKSALKEGVDSTEKT
QEAFSSILSSSKHVKEKTGEINNSVSVTQKGLKEISNDINEIMNSSKDVNTEIVDLNIQS
SEKSIIFSDIINFLEQLDTISIEKMNALKK
NT seq 993 nt   +upstreamnt  +downstreamnt
atgcttgaattatttagaaaaaataaaaaaatagatgttgaagtaagtagtagtgataat
aatgaaaaagaaataaaatcaattgatgatattagtgaacaacagtgtattaattatagt
ttaagttacatacaagaaagaatgtctaaccttatggatagtgaaattaacatatccaag
acagtaaatgatgtttcaagaacctttaatcaggtatctggaagtatagataaaattgga
aatgtattagataattttaatgataatttcaaccattttgcagaaagttcaagtaatata
gatacggctacagatgattctataaaggctctagataatgcaaatattatgatggctgat
ttaaaaagtaaaatgcataatatagagaagagtatgaatgaatttgcaaatacatttttt
attcttaaaagttcttttaaagatataggtaagctatcaaacagcattagcgatgtagct
aatgaaacaaatcttcttgcattaaatgcaaatattgaagctgcaagagctggagaagca
ggaaaagggtttgctgttgttgcagaagaggttagaaaactagcagattcaactaaagaa
ttggtagatggtataaataaaaaaatggctgaaatggataataatgttgaaaacctttct
agttctgtagaatattcaaaatcagctttaaaggagggagtagattcaactgaaaaaact
caggaagctttttcaagtattcttagttcctcaaagcatgtaaaagaaaagacgggagaa
attaataattctgtaagcgttacccaaaaaggacttaaggaaatatcaaatgacataaat
gaaataatgaattcctcaaaggatgtaaatactgaaattgttgacttaaatatacagtcg
tctgaaaaatcaataattttttcagacataattaattttttagaacaacttgatactatt
tccatagaaaagatgaatgcattaaaaaagtag

KEGG   Clostridium carboxidivorans: Ccar_08750
Entry
Ccar_08750        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_08750
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_08750
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_08750
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_08750
SSDB
Motif
Pfam: MCPsignal dCache_1 HAMP dCache_2 Mce4_CUP1 HAUS-augmin3 DUF1664 Laminin_II DUF948 sCache_like BLOC1_2 Spc7 H_kinase_N OAD_gamma ATG16 DUF4200
Other DBs
NCBI-ProteinID: AKN30926
UniProt: C6PZ50
LinkDB
Position
complement(2036130..2038124)
AA seq 664 aa
MKSIKSKMIVFSGLLICIICIGLGVISFINSSKALNTNLGKTLPKIAEQTANNVQSKLEG
QLNVLAAIAARSEIRDTNNSWQNKIQILTEEGKRIGSVRLEAVDKNGNITKPDGTIVNVK
ERDYFQKAVSDKSNVSDPFVSKTGGDVVVVYAVPIKNNNEVVGVLIETRDGNRLSDITNA
VKFGKTGYAFMMKKDGTNIASNNKDLVLKMYNPIEAAKKDSKLQPLAEIEKKMGAGETGI
GEYSYEGIYKYMGYAPVKGTEWSVGVIVEKGEILSELTSLRISVIAFSILFILIGAVMIY
IIANSISRGIKSTSKYLDLLAEGNLSEEVPTRYLQMKDEVGDMSNSMKVMQESLRSMINR
IKENSANINMQSENLSSVSEEIASSSQSVAEAIDEIAKGTSSQSQDLINVTDILNDFSNK
LSRMVNEVQDVDSKSREISLMAKESSTEMNGLNQSVSKVSNSFKTFNGKIVGLGKSINEI
NEIINIINSIAEQTNLLALNAAIEAARAGESGKGFAVVADEIRKLAEQSQVSAEDISKLI
SEISQNTDTIVKDSSDMDGELINQVKIIESSIVSFKNIIEAVSEVIPKIEVVKNSAEGID
NDKNTILNRVNDVSSVSLEVSATSEEISASSQEMNATTEEVAASSQVLSNMTKEMLDEVN
KFKI
NT seq 1995 nt   +upstreamnt  +downstreamnt
atgaagagtattaaatcaaaaatgatagtgttttcaggtttgctaatatgtattatatgt
ataggattaggtgtgatttcgtttataaattcatcaaaggcattaaatacaaatttgggt
aaaacacttcctaaaatagcagaacaaacagcaaataatgttcaaagtaaacttgaaggg
cagctgaatgtattagcagccattgcagcaagatctgaaataagagacactaataattca
tggcaaaataaaattcagattcttacagaagaaggtaaaagaatagggagtgtcaggcta
gaggctgtagataaaaatggaaacataacaaaacctgatggaacaattgttaatgttaaa
gagagagattattttcaaaaagctgtatctgataaaagcaatgtatcagatccgtttgta
agtaagactggtggagatgtagtagttgtatatgcagttcctattaaaaacaataatgaa
gttgtaggagtattaattgaaacgagagatggaaatcgtttgagtgacataactaatgca
gtgaaatttggaaaaacaggttatgcatttatgatgaaaaaggatggtacaaatattgct
agtaataataaagatttagtccttaaaatgtataatccaatagaagcagcaaaaaaggac
agtaaacttcagccattagctgaaattgaaaagaaaatgggagcaggagaaacgggaata
ggtgaatattcttatgaaggaatatataaatacatgggttatgctccagttaaaggaact
gaatggtctgttggagttatagtggaaaaaggagaaatactctctgagcttactagttta
agaatttctgttatagcattttctatattgttcatattaattggagctgtaatgatttat
attattgctaatagtatatcaagaggaataaaatcaacttcaaaatatttggatttattg
gcagaaggaaatttaagtgaagaagttcctactagatatctgcaaatgaaagatgaagtt
ggagacatgagtaattcaatgaaagtaatgcaggaatcattaagatcaatgattaataga
ataaaagaaaattctgcaaatattaatatgcagtcagaaaatttatcttctgtttcggaa
gaaatagctagttcatcacaaagtgttgcagaagcaatagatgaaatcgcaaaaggaaca
agttctcagtctcaggatttaataaatgtaacagatattcttaatgattttagtaacaaa
ttgtccagaatggttaatgaagtacaggatgtggactcaaagtccagagaaattagttta
atggcaaaagaaagtagtacagaaatgaatggattaaatcaatctgtatcaaaggtgagt
aattcatttaaaacttttaatggtaaaattgtggggcttggaaaaagtataaatgaaata
aatgagattataaatataataaacagtattgcagaacaaacaaatttattggcattaaat
gcagctattgaagctgcaagagcaggagaatcagggaagggatttgcagttgttgcagat
gaaataagaaagcttgcagaacaatctcaagtgtcagcagaagatattagcaaattgatt
agtgaaatatcccaaaatactgatactatagttaaagattctagtgatatggatggtgaa
ttaataaatcaagttaagatcatagaaagttcaatagtgtccttcaaaaatattatagaa
gcagtaagtgaagtaattcctaaaattgaagtagttaaaaattctgctgaaggtatagac
aatgataaaaatactattttaaatagggtaaatgatgtgtcttcagtttcacttgaagtt
tcagcaacttctgaggaaatttcagcatcatcacaagaaatgaatgctactacagaagaa
gtagcagcatcatcacaagtacttagtaatatgactaaggaaatgcttgatgaagtaaat
aaatttaaaatttaa

KEGG   Clostridium carboxidivorans: Ccar_08790
Entry
Ccar_08790        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_08790
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_08790
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_08790
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_08790
SSDB
Motif
Pfam: MCPsignal CZB SKA1 DUF948 DUF1664 DASH_Duo1 BLOC1_2 Laminin_I DUF211 ISG65-75 RPW8 Fib_alpha Spc7 TMEM95 ZapD Mod_r NPV_P10 Laminin_II DUF3450
Other DBs
NCBI-ProteinID: AKN30934
LinkDB
Position
complement(2046484..2047875)
AA seq 463 aa
MFKKLLKNTEEKKSEYLSNAEYIHKDVLIKLFSDVIQGKPRKLTLDDVKCSDVVDKWNEV
IDVLCSSRRKSVLEVNDLLQKVTRMDSVRDIIKSVDTQTEALHSMSANSEELAASIEEVS
NMSQKMSQYSSDTKQVSEAGVSSVSESIEFVKKSFEDIEIINNKMQMVKEKTHKINEIID
IVKGIADQTGLLALNASIEAARAGEHGKGFAVVANEVKKLAEHTTNSVLDIQNNVSALQN
DIDSSVNKIEQTSKQLDSGKQLVNNSLDSINLIDHSIDTVNETVDQVTANTEEQTAVTQS
FTSSIMELSQHADYIDNGCVGMGKTIYDLSKKIDSIRLDMIEDRFCLTDCDMINVYETDH
LLWRWKVYNMFLGNEKVNINVVGDYKGCRLGKWYYGIGCDKFRDNKAFIELEKPHIELHD
AAKEAVIAYERGDIKLAEQCLEKMDMCSKKVFTLMGGIKKLLS
NT seq 1392 nt   +upstreamnt  +downstreamnt
ttgtttaaaaaattattaaaaaacacagaagagaaaaaaagtgaatatttaagtaatgca
gagtacattcataaggatgtacttataaagctattttctgatgtaatacagggaaaacca
agaaaattaactttagatgatgtaaaatgcagtgatgtagtagacaaatggaatgaggtt
atagatgtattatgtagttcaaggagaaaatcagttcttgaagtaaatgatttactacaa
aaggtaactagaatggattctgttagggatattattaaaagtgttgatacacaaacggaa
gcattacattccatgtcagcaaatagtgaagaattagcagcatctattgaggaagtttct
aatatgtctcagaaaatgtcacaatactcaagtgatacaaaacaagtatctgaagcgggg
gtatcaagtgtatctgaatctattgaatttgtaaaaaagtcatttgaggatattgagatt
ataaataataaaatgcaaatggttaaagaaaaaactcataagataaatgaaataattgat
attgtaaaaggtattgcagatcaaacaggtttattggcattaaatgcttccattgaagca
gcaagagcaggggagcatggtaaaggctttgctgttgttgcaaacgaagttaaaaaactt
gctgaacacactacaaattcggttttagatatacaaaacaatgtttccgctctacaaaat
gatatagattcatcggttaataaaattgaacaaacatctaaacaattggattcaggtaaa
caattagttaataattcattggattcaattaacttaattgaccattccatagatactgtt
aatgaaacagttgatcaggttacagcaaatacagaagaacaaactgcagtgactcaatcc
tttactagcagtattatggaattatcacaacatgctgattatatagataacggttgtgtt
ggaatgggaaaaactatatatgacttaagtaaaaagatagattccattagattagacatg
attgaagatagattttgtttaacagattgtgatatgataaatgtttatgaaactgatcac
ttactttggagatggaaagtatataatatgtttcttggtaatgaaaaagtaaatattaat
gttgtaggagactataagggatgtaggcttggaaagtggtattatggtatagggtgtgat
aagtttagagataataaagcttttatagaattagaaaaacctcatatagaattgcatgat
gcagcaaaagaggctgttattgcatatgagagaggggacataaagttggcagaacaatgt
cttgaaaaaatggacatgtgttctaagaaagtgtttactttaatgggtggaataaaaaaa
ttattatcttaa

KEGG   Clostridium carboxidivorans: Ccar_08810
Entry
Ccar_08810        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_08810
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_08810
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_08810
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_08810
SSDB
Motif
Pfam: MCPsignal dCache_1 Cache_3-Cache_2 dCache_2 HAMP TMP_2 sCache_3_2 Cadherin_C_2 DELLA DUF4492 Laminin_II Lipoprotein_7
Other DBs
NCBI-ProteinID: AKN30938
LinkDB
Position
2051544..2053529
AA seq 661 aa
MKKRNSLQLKAICIISFIFILIISILTVICYNNSKKSILNSMESSGKQTVTIHAQDLSSW
VNSRLSQMQVIANTELVSSMNYDKILPYFQREQKNYNGIYNTLGIGDTSGKLILQNGTVI
DISSESTFSLVMQGKSVISNPFSAKQSPSDWIISMECPVKDTGTNNVIGVVSGACLVSTV
FKETTNFHLGKTDKVYILNKDGTVLFHPDNKLINTSNFLKSSNSQYASLVKQAVSQNSFS
GEFKDNTETKMLFSSHVDGTDWYMFLEVPTNEYISGINSLLYSTSILAIISIILLIIILT
FLTKYFFNRLLNVSTAAERVADGYLVNYLPETPDELGTFNATFNKMVKNLKDIVLKLRNV
SNIVSSSSKNYKEIGFKVAESAKCIQENITDLASGSKVAASEISNVTKYIGDMEKQSKSL
VDISVNIDAMILEAKNNVSDGSHNLNSTMDLLDNMKNSILNSSKVITKLSDGSKNIENIT
TSISSISDQTNLLALNASIEAARAGEHGKGFSVVAEEIRKLAEQSSTSTEEISREISEIQ
KQILEASSTMKDSINYMESGTSSMETISDVFSKIANKIEKIKNVSSDVSEIAKKLLNENI
NIHKAISNVSSISEEAAANTSSTEEIVNDQEKMFLELKTASKELEDLSILLSNEISKFKI
D
NT seq 1986 nt   +upstreamnt  +downstreamnt
atgaaaaagcgaaattcactacaacttaaggcaatttgtataatatcttttatttttatt
ttaataataagtattcttaccgttatttgttataacaattcaaaaaaatcaattttaaat
tctatggaaagctctggcaaacagacagttactattcatgctcaagacttgtcttcttgg
gtaaattcaagattatcacaaatgcaggtaattgcaaatacagaattggtatcaagtatg
aattatgataaaatactaccttactttcagcgtgaacaaaaaaattataatggaatttat
aatactttaggtattggtgatacaagcggaaagctaattttacaaaatggaactgtaatt
gatataagttctgaaagcactttttctttagtgatgcagggtaaatcagttatatcaaat
ccatttagtgccaaacaaagcccttctgattggattatatctatggaatgtcccgtaaaa
gatacaggaactaataatgttattggtgttgtaagcggtgcttgccttgtttctacagtg
tttaaagaaactactaattttcatttaggaaaaacagataaagtgtatatacttaataaa
gatggtactgtattattccatccagacaataaactaattaatactagtaactttctaaaa
agctccaacagtcaatatgcaagtttagttaaacaagctgtttctcaaaatagtttttct
ggagaatttaaagataatactgaaacaaaaatgcttttttcatcacacgttgatggaacc
gattggtacatgtttctagaagtacctactaatgaatatattagtggcataaactcctta
ttatattcaactagtattctagcaattatttcaataattttattaattataatactaact
tttttgacaaaatacttttttaacagattattaaatgtatctacagctgctgaaagagta
gctgatggatacctagttaactatttacccgaaaccccagatgaattaggaacatttaat
gctacttttaataaaatggtaaaaaatttaaaggacatcgtattaaagttaagaaatgtt
tcaaacattgtttcatcatcttctaaaaattataaagaaattggctttaaagttgctgaa
agcgctaaatgtattcaagaaaacattacagatttagcttcaggttctaaagtagctgct
tctgaaatttcaaacgttaccaaatatattggtgacatggaaaagcaatcaaaaagtcta
gtagatataagtgtaaatattgacgccatgatattagaggccaagaacaatgtatctgat
ggttcccacaatttaaattctacaatggacttattagacaatatgaaaaatagtatatta
aattctagtaaagttataacaaaactttctgatggatctaaaaacattgaaaatataaca
acttcaataagctctatatcagatcaaacaaatttattagctctaaatgccagtattgaa
gctgcaagagctggcgagcatggtaaaggtttttctgtagtggcagaagaaattagaaaa
ttagctgaacaatcttctacctcaactgaagaaatatctagagaaatatctgaaatacaa
aaacaaatattagaagcttcatcaactatgaaagacagtataaattatatggaatcaggt
acaagctctatggaaactatttcagatgtattctctaaaatagccaataaaattgaaaaa
ataaaaaatgtcagttctgatgtatctgaaattgcaaagaaactgctaaatgaaaatata
aatattcataaagctatttcaaatgtttcttcaataagtgaagaagctgctgccaatacg
tcatctactgaagaaatagtaaatgatcaagaaaagatgtttttagagcttaaaactgct
tcaaaggagctagaagatctttcaatactattgtcaaacgaaatttctaaatttaaaatt
gactag

KEGG   Clostridium carboxidivorans: Ccar_09245
Entry
Ccar_09245        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_09245
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_09245
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_09245
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_09245
SSDB
Motif
Pfam: MCPsignal HAMP_2 HAMP
Other DBs
NCBI-ProteinID: AKN34149
LinkDB
Position
complement(2152958..2154484)
AA seq 508 aa
MIIAVVAVVASILLGYYISNIISKPIKKLLKSADNISEGNLNIDIDIDSKDEVGNLAQSF
KKMIMVIKSLVSDTNMLVDAAVEGKLDVRADADKHSGDYKKIVEGVNKTLDEVIRPVKES
AEVLNEMSNGNLKVRVKGDYKGEHAKIKNALNDTIDSLYSYITEISGVLEEMSNSNLQLS
INNEYKGDFSRIKDALNLIIQSFNEVFTEINRAADQVSGGSNQVSDGSQALSQGATEQAS
AIEELSVSITEVATQTKENAANATQASELANSVKDGAVLGNSHMKDMLKSMEEINEASSN
ISKIIKVIDDIAFQTNILALNAAVEAARAGQHGKGFAVVAEEVRNLAARSASAAKQTTDL
IEGSIKKVEAGTKIANNTAKSLDEMVVRVSKASTLVGEIAAASNEQATAISQINKGIEQV
SSVVQTNSATAEESAAASEELSSQALMLKSMVGKFKLKGGSLLADNRIVSSNHENRKQFR
DNSLAYNEAAVSTNKPRISLSDAEFGKY
NT seq 1527 nt   +upstreamnt  +downstreamnt
atcattatagcagtagttgcagtagttgcatcaatattacttggatattatatatcaaat
ataataagtaaacctattaaaaaattacttaaatcagcagataacatttcggaaggcaat
ttaaatattgatatagacatagattctaaggatgaagttggaaatttagcacaatcattt
aaaaaaatgattatggttataaagtcattagtaagtgatactaatatgttagtagatgca
gcagttgaaggtaagctggatgtgagggcagatgcagataagcatagtggggattataaa
aagatagttgaaggagtaaataaaacattagatgaagtaataagacctgtgaaggagtca
gcagaagtattaaatgaaatgtcaaatggtaatttaaaggtacgtgttaaaggagattat
aaaggagaacatgctaagattaaaaatgcattaaatgatactatagattcattatattct
tatataactgaaatttcaggggttttagaagaaatgtccaattcaaatctccaattgtca
atcaataatgaatataaaggggattttagcagaattaaagatgcattaaatcttataatc
caatcctttaatgaagtatttacagaaataaatcgtgctgcagatcaagtttctggaggt
tcaaatcaggtttcagatggcagccaagctctttcacaaggtgctacagaacaggcaagt
gccatagaagaattgagcgtctctattacagaagtggcaactcaaactaaggaaaatgca
gctaatgctactcaggctagtgagcttgcaaacagcgttaaagatggagctgtactggga
aattctcatatgaaggatatgcttaaatccatggaagaaattaatgaagcatcttctaat
atttctaaaataattaaggttattgatgatattgcatttcaaactaatatattagcttta
aatgcagcagttgaagcagcaagggcaggacaacatggtaaaggttttgcagtagtagca
gaagaagtgagaaatcttgccgcaagaagtgctagtgcagctaagcaaactacggattta
attgaaggttctattaaaaaagtagaagctggaacaaaaattgccaataacactgctaaa
tctcttgatgaaatggtagtgagagtatctaaggcatcaactttagttggggaaatagca
gcagcttcaaatgaacaggcaacagcaatatctcaaataaacaaaggcatagagcaggtt
tcaagtgttgtgcagactaattcagcaactgcagaagaaagtgcagcagctagtgaagaa
ctttcaagtcaagcattgatgctcaaaagtatggtaggaaagtttaaattaaaaggaggc
agcttattagccgataacagaatagtatcatcaaatcatgaaaataggaaacaatttaga
gataattctttagcttacaatgaggcagctgtatctacaaataagcctagaatatcttta
agtgatgcagagtttggaaagtactaa

KEGG   Clostridium carboxidivorans: Ccar_09580
Entry
Ccar_09580        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_09580
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_09580
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_09580
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_09580
SSDB
Motif
Pfam: 4HB_MCP_1 MCPsignal TarH IFT57 Vps53_N DUF1664 HAMP DUF948 Serine_rich DUF211 TMPIT
Other DBs
NCBI-ProteinID: AKN31087
UniProt: C6PPZ4
LinkDB
Position
2209718..2211430
AA seq 570 aa
MGFLGNIKVRTKLFTSFFIMSILIAIVGAIGITSLKTINTNSEEMYNNRLQSTYMLTDMR
QNLTEIKSDLLQLTYVKDTTKKTDLEKDIKQNNDENDEYIKAYEKLSMNDTEKQVWSPFK
THLGLYTTSVKNVVKLIDAGNFDEALKQSQLLPSVENSMIEDIDKLINANLDGAKTFNTA
NHLIYVNSNKIMTTLAIAGLLIAIAFGFIISKDINIPLMKTLSLAQNLSNFDLTHNYSIT
RKDEFGETGGALQKAQENIRELVSLIIENSQDLSASSEELSATVEELSAKTQEIDSSVKN
ITNSVQESSASSEEIAASIEEVDSSINELSIKAADGSNNANQSKKRATTVEENGKNAITK
VRNLYEEKEKNMIMAIEAGKVVDNIRVMADTIASISEQTNLLALNAAIEAARAGEQGKGF
AVVADEVRDLAEQSSQAVAGIQDTILKVQDAFKNISENGNEILKFINESVDPQFEDFEKM
GNQYYKDSEVVTEMCEGIASMSEELTATIGQVNNAVQSMSGTAQKSSENTETIKTSIDET
TKAIKQVALTAQSQAELAQKLNEMVHKFKL
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgggatttttaggaaacataaaagttagaaccaagctatttacatctttttttattatg
tccatattaattgccatagttggcgctattggtataacatcattaaaaacaataaataca
aattcagaagaaatgtataacaatagattacaaagtacttatatgttaacagatatgaga
caaaatttaacagaaattaaaagtgatttgttacagcttacttatgtaaaagatactact
aaaaaaactgacttagaaaaagatattaaacagaacaatgacgaaaatgatgaatatata
aaagcttatgaaaaattatctatgaacgatacagaaaagcaagtatggtcaccatttaaa
actcatttgggactatatacaacctcagtaaaaaatgttgtaaaacttattgatgctgga
aactttgatgaagcattaaagcaatctcaattattaccttctgtagaaaattcaatgatt
gaagatattgataagttaataaacgcaaatcttgatggtgctaaaaccttcaatacagcc
aatcacttaatatatgtaaattcaaacaagattatgacaacattagcaatagccggcttg
ctaattgcaattgcatttggatttattatatcaaaagatataaacattcctttaatgaaa
acactatctttagcacaaaatttatctaattttgatttaacacataattattcaattaca
agaaaagatgaatttggagaaacaggaggagcacttcaaaaagctcaagaaaatattaga
gaacttgtaagcttaataattgaaaattcacaggacctgagtgcatcaagtgaagagctt
tctgctacagtggaagaattatctgcaaaaactcaagaaatagatagctcagtaaaaaat
ataaccaatagtgttcaagaatctagtgcatcatctgaagaaatagctgcatctatagaa
gaagtagattccagtattaatgaactatctataaaagctgcagacggaagtaacaatgca
aatcaatctaaaaaaagagctactacagttgaggaaaatgggaaaaatgctataacgaaa
gttagaaacttatatgaggaaaaagagaaaaatatgataatggcaattgaagctggtaaa
gttgtagataatataagggttatggcagataccattgcaagtatatctgagcaaaccaat
ttacttgcacttaatgcagccattgaagctgctagagctggggaacaaggaaaaggcttt
gctgtagttgcagacgaagtaagagatcttgcagaacaatcttctcaagccgtagcaggt
atacaagataccattttaaaagttcaagacgcttttaaaaatatatctgaaaatggtaat
gaaatactaaaattcataaatgaaagtgttgatcctcaatttgaggattttgaaaaaatg
ggaaatcaatattataaggattcagaagttgtaacagaaatgtgcgaaggtatagcatcc
atgtcagaagagcttacagcaacaattggtcaagtaaataatgcagtacagagtatgtcg
ggaactgcacagaaatcatcagaaaatacagaaacaataaagacaagtatagatgaaaca
acaaaagcaataaaacaagttgccttaactgcacaaagtcaagcagaacttgcacaaaag
cttaatgagatggtacataaatttaaactataa

KEGG   Clostridium carboxidivorans: Ccar_09770
Entry
Ccar_09770        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_09770
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_09770
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_09770
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_09770
SSDB
Motif
Pfam: HAMP_2 MCPsignal HAMP PAS_4 PAS COG2 MSP BLOC1_2 IL31 DUF948
Other DBs
NCBI-ProteinID: AKN31125
UniProt: C6PPV2
LinkDB
Position
complement(2257612..2261022)
AA seq 1136 aa
MKWFSNLKISTKLMFGFIVVALMYTMSGIYAINQLSPSSNHGAVDVNRTMMTMIGMIIFV
IIMSMLIGFFISRSIAIPLKKILYVIQEMDQGHLSERVKIDSNDEIGQISKAMDNFADEL
QTKVIGVMNSISQGDMSMDIIEKNKKDEISPALKKTVESIKSLVQDVNMLSQASLEGKFE
VRANESRHQGDYKKVIEGVNGTLDTVIDKVVWYEAIIDAIPFPIHVTDNDMKWTYMNKSF
EKLMIEQGVIRERNSGYGLACSHAGANICNTENCGIKQLLRGKAESFFDWCGMNNKQDTS
YLKNKKGENVGYVEVVTDLTPIIKVSDYTKNEVKRLEENLKLLSKGNTNFDFNIKEADKY
TVEVNKQFEGINNSLKDVKSAVDGLAADASMLSDAALQGKLNTRADAEKHHGDFKKIVEG
VNSTLDSVIGPLNVAATYVDRIGKGDVPSKITDDYSGDFNEIKNSLNNCIDNVTLLLKDV
NMLAEEAIEGRFETRAEAVKHHGDFKKVIDGINGTLDTVVDKVVWYEAIIDAIPFPIHVT
DNDMNWTYMNRAFEKLMIEQGVVRDRKSGYGLACSHAGATICNTEKCGIKQLLRGNPESF
FDWCGMNNKQDTSYLKNKKGENVGYVEVVTDLTPIIRVSNYTKNEVNRLEENLKLLSQGN
TSFDLNIEEADKYTAEVNKQFEGINNSLKDVKSAVDELISDASMLSNAALEGKLDTRADA
EKHGGDFKKIVDGINHLVEAVVKPIKEVTNVMSEISKGNLDVSVNGDYKGEFLLLAQSVN
STAVDLRHVIEEISGIIEQIAEGNLAIDHVREFKGDYVSISNSLNTILDSLNDVIGEMNT
ASEQVSTGSSQVSDGSQALSQGATEQASAIEELTSSVTEIASQTKENAINANEANQLSLK
VKENAEQGNVAMSEMLKSMAEINESSANISKIIKVIDEIAFQTNILALNAAVEAARAGQH
GKGFAVVAEEVRNLAARSANAAKETTALIEGSIDKAEKGTEIANDTAKALYEIVDGVSKV
TTLIAEIAASSNEQDTGISQINLGLEQVSQVVQTNSATAEESAAASEELSSQAEILKDMV
SKFKLRGVNMNLFRKEVNSHKNRQPQSGQMNLSFKEAAFSSNKPKIALSDKEFGKY
NT seq 3411 nt   +upstreamnt  +downstreamnt
atgaaatggttttctaatttaaaaattagtacaaaattgatgtttggttttatagtagta
gcattaatgtatacaatgagtgggatttatgctattaatcaattaagtccttcttcaaat
catggtgctgttgatgtcaatagaaccatgatgacaatgattggaatgattatctttgtc
attataatgtccatgctaattggattttttatttcaagatcaattgcaattccacttaaa
aaaatattatatgtaattcaagaaatggaccagggacatcttagtgaaagagtgaaaata
gattccaatgatgaaataggacaaatatctaaagcaatggataattttgcagatgaatta
caaacaaaggttattggagtaatgaatagtatctctcaaggagatatgagtatggacata
attgaaaaaaataaaaaggatgaaatatctccagctttaaagaaaactgtagaatctata
aaatctttagtacaagatgtaaatatgttatcacaggcttctttggaaggtaaatttgag
gtaagagcaaatgaatccagacatcaaggagattataagaaagttatagaaggggtaaat
ggaaccttagacacagtaattgataaggttgtatggtatgaggctattatagatgctatt
cctttcccaattcatgtaacggataatgatatgaaatggacatatatgaataagtctttt
gaaaagcttatgattgaacaaggagttattagggagcgtaactcaggttatggattagcg
tgcagtcatgcaggtgccaatatttgtaatacagaaaattgtggaataaagcagctgctt
agaggtaaagcagaaagcttctttgactggtgcggcatgaataataaacaagatacctca
tatttaaaaaataaaaagggcgaaaatgttggatatgttgaagttgtaacagatttaaca
cctattattaaagtttctgattatacaaaaaatgaagttaagagacttgaagaaaattta
aaattgttatcaaagggaaatactaattttgattttaacatcaaggaagcagataaatat
actgtagaagttaataaacagtttgaaggaataaataacagcttaaaagatgttaagagt
gcagttgatggacttgcagctgatgcgtcaatgttatctgatgcagctcttcaaggtaaa
ttaaatactagagcagatgctgaaaaacatcatggagactttaaaaaaatagtagaagga
gtaaattctactcttgattcagtaataggaccattaaatgttgcagcaacctatgtagat
agaataggtaaaggtgatgtaccatccaagataacagatgattattcaggagattttaat
gaaataaagaatagtttaaataactgtatagataatgtaactttattattaaaagatgta
aatatgttggcagaagaggctatagagggtagatttgagacaagggcagaagcagtgaaa
catcatggtgatttcaaaaaagtcatagatggtataaatggaactttagatacagtagtt
gataaggttgtatggtatgaggctattatagatgcaattcctttcccaattcatgtaacg
gataatgatatgaactggacatacatgaatagagcttttgaaaagctaatgattgaacaa
ggagttgttagggatcgtaagtcaggttatggactagcatgtagtcatgcaggtgctact
atttgtaatactgaaaaatgtggaataaagcagttacttagaggcaatccagaaagcttc
tttgactggtgcggcatgaataataaacaagatacttcatacttaaaaaataaaaaaggt
gaaaatgttggatatgttgaagttgtaacagatttaacgcctattataagggttagtaat
tatacaaaaaatgaagtcaataggcttgaagaaaacttaaaattactgtcacaaggaaac
actagctttgatcttaatattgaagaagcagataagtatactgcagaagttaataaacag
tttgaaggaataaataacagtttaaaagatgttaaaagtgcagttgatgaacttatatct
gatgcttcaatgttatctaatgcagctcttgaaggtaaattagatactagagcagatgct
gaaaaacatggaggagatttcaagaaaatagtagatggcataaatcatctagttgaagct
gtagtaaaacctattaaagaagttactaatgttatgagtgaaatttcaaagggtaattta
gatgtttctgttaatggagattacaaaggagaatttttactattagcacaatctgtaaat
agtacagctgtagatttgaggcatgtcattgaagaaatatcaggtattatagaacaaata
gctgagggcaatcttgctattgatcatgtaagagaatttaaaggagattatgtaagtatt
tctaattcattaaatacaatattagattctttaaatgatgtaattggtgaaatgaatact
gcttcagaacaggtatccacaggttctagtcaggtttcagatggcagtcaagcattatca
caaggagctacagaacaagctagtgctattgaagagttaacttcttctgtaactgaaatt
gcatcacaaactaaagaaaatgctattaatgcaaatgaagcaaatcagttatctctaaag
gtaaaagagaatgcagaacaaggcaatgtagcaatgtctgaaatgcttaaatccatggca
gagataaatgaatcttcagctaatatttcaaaaataataaaagtaatagatgaaatagct
ttccaaactaatatattagcacttaatgcagcagtagaagcagcaagggcaggtcagcat
ggtaaaggctttgctgtagttgctgaagaagtaagaaatcttgcagcaagaagtgcaaat
gcagctaaggaaactacagcacttattgaaggttcaatagataaggctgaaaaaggaact
gaaattgcaaatgatacagcaaaagctctgtatgaaatagtagatggtgtatcaaaggta
accactctaatagcagaaatagcagcatcttctaatgagcaggatactggtatttctcag
ataaatttaggacttgaacaagtatcacaggtggttcagaccaattcagcaacagcagaa
gaaagtgcagcagcaagtgaagaactttcaagccaggcagaaattcttaaagatatggtt
tctaaattcaaacttagaggtgtcaatatgaatttatttagaaaagaagtaaattcacat
aaaaatagacagccgcaaagtggacaaatgaatttatcttttaaagaagcagcgttttca
tcaaataaacctaagattgcactaagcgataaggagtttggcaagtactaa

KEGG   Clostridium carboxidivorans: Ccar_09960
Entry
Ccar_09960        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_09960
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_09960
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_09960
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_09960
SSDB
Motif
Pfam: MCPsignal DUF948 Fib_alpha T4SS_CagC DUF1484 SKA2
Other DBs
NCBI-ProteinID: AKN31155
UniProt: C6PX25
LinkDB
Position
2307342..2309090
AA seq 582 aa
MKKWKLNNIKLSVKMIFSLIVPIASLILISCISIKYINQIHNGLIKNIYEETHMSEYWLL
NADRDFYQALTAQMGMENTSDPKALKDAKSSYLENQKQTIDRVHKARDIIYSDKTKFENM
KHKDSKLTLIQLFDSFDKDFSNWSNLFDPDKNVLTNKAEYLKNFDMARERINQIEEIMDD
YNSRVISENRSLVNSITNIVIIVSLCTIFLSILLGLYLIINIKKRTNVSIALMKKTAKFD
LKYDKSYEKYLSEKDEFAEIINAESSIRREFSSIIKKVTEETIVLNDAIKIVNENIFSLK
DEIEDISSTTEELSAVMEETAASTQETTAASSEIEKHIEDISSKAVLGSKSVESINERAS
KLKNDFSISHNNTLEMLNMVKEKLKKSLTQSKSVNQINELSNSILEITSQTNLLALNASI
EAARAGEAGKGFAVVADEIRNLAETSRTSVNQIQEITKVVIDCVESLTNNSNELLKFVET
DVTCDYKTMLDATDQYKLDADLVNDLVDNFSSTSKELVSSVENIVTTMSGIAEATNEGAL
GTSNIAEKVSSVVSKANEIKESINSTEEGFKALNDMISKFNV
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgaaaaaatggaaattaaataatattaagctgagtgtaaaaatgatatttagtctaata
gttcctattgcttcactaatattgatttcatgtatttctataaaatacataaaccaaatt
cacaatggattgataaaaaatatatatgaagaaacacacatgagcgaatattggctgctt
aatgcggatagagatttttatcaagcattaactgctcaaatgggaatggaaaatacctca
gacccaaaagctttaaaggatgcaaaatcctcttatttagaaaatcaaaaacaaactatt
gatagagtccataaagcacgagacataatatatagtgacaaaactaagtttgaaaatatg
aagcataaagattcaaagttaacattaattcaattatttgattccttcgataaagatttt
tccaattggtcaaatctttttgatcctgataaaaatgtattaaccaacaaagcagaatat
cttaaaaattttgatatggcaagagaaagaataaatcaaattgaagaaataatggatgat
tacaattccagagtaattagtgaaaatcgctccctagtaaattctattacaaatatagta
attattgtttcattatgtacaatttttctttcaattttgctaggattgtatttaattatc
aacataaagaaaagaactaatgtatccatagcattgatgaaaaagacagcaaaatttgat
ttgaaatatgataaaagttatgaaaaatatttatcagaaaaagatgaatttgcagaaatt
atcaatgcagaatcaagtatcagaagggaatttagcagtattataaagaaagttactgaa
gaaactatagtcttaaacgatgctattaaaatagtaaatgaaaatatattttctcttaaa
gatgaaatagaagatatatcctccaccacagaagaactgtctgctgtcatggaagaaaca
gccgcatctactcaagaaacaacagctgctagttctgaaatagagaaacatattgaagat
atttctagcaaagctgtgttaggttcaaaatcagttgaaagtataaatgaaagagcttct
aaattaaaaaatgatttttcaatatctcacaataatactttagaaatgcttaatatggta
aaagaaaaattaaagaagtctttgacacaatctaaatctgtaaatcaaattaatgaatta
tctaattccatactagaaataacttcgcaaacaaacctattagcacttaacgcttctata
gaagctgcaagagctggtgaagcaggaaaaggttttgctgttgttgctgatgaaataaga
aatcttgcagaaacttcaagaacatcagttaatcagattcaagaaataacaaaagtagtt
attgattgtgtagaaagtttaaccaataattcaaatgaactgcttaaatttgtagaaacc
gatgttacctgtgactacaaaacaatgttagatgccacagatcaatataaacttgatgct
gacctagtcaatgatttagtagacaactttagttcaacctctaaagagttagtatcatcc
gttgaaaatatagtaacaactatgagcggtatagccgaagccacaaatgaaggtgcactt
ggtacaagcaatattgctgaaaaagtatcctctgtagtaagtaaggcaaatgaaataaaa
gaaagtattaattccactgaagaaggttttaaagctctcaatgatatgatttcaaaattc
aatgtataa

KEGG   Clostridium carboxidivorans: Ccar_10020
Entry
Ccar_10020        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_10020
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_10020
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_10020
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_10020
SSDB
Motif
Pfam: MCPsignal dCache_1 HAMP Transpeptidase Laminin_I Mce4_CUP1 DUF3540 Sec34 GAS Lebercilin DUF812 UPF0242 GCN5L1
Other DBs
NCBI-ProteinID: AKN31166
LinkDB
Position
complement(2320513..2322534)
AA seq 673 aa
MGGIKLKFKSIKTKMAISFGVLILIICIGLGTVSFIESYNTLASNATESLFQMAEQSAKF
VETKVEGQLDAMEALAGNYYIKSDTLPVDQKLNILKDEVQRSGHISMGIGDVSGNVIFTD
GVKANLYDRENYKQALQGKSSVSDPVLGKADNRLVMSYAVPIKDGGKVKGVLIATRDGSE
LSKLTQNIKYGKTGTTFMISKSGHNVANNDISLVRKMENVIEKSKSDPSLQELMKFEGYM
MEGKSGAAGYTYRDGTKKYIGYAPVKGTNWSLGISVPKSEVMESLTKNEILETATTIIFV
LIGVLIAFFITSLIAKPINAITKHLKIVASGDFTIPVPEKLLKMEDESGILATAVKDMQE
SQGNIIKNIIEQSSNVTENMKQINMEMENLNKSIEEISATTEQLSDTTEKTAESAEEIND
ISKTIENNAESISQKAEHSSESVSKASNMSEEMKQKAIKSRESIMSIYKNTKESLENAIK
ESKEVSKINELSSAILDIMENTNLLALNASIEAARAGEAGKGFAVVADEIRSLSDDSKDT
VGRIQEVTKNILEAVGNLSSGAYEILEFIDKKILPDYNEIVVSHEKSSKNFSDISDMVTD
FSTTSHELLSSVQNVSKLMEEISDSGNEQASGAQNIAGETSYITRMSGHVVELTEKAKEK
SDSLVNTVSKFKV
NT seq 2022 nt   +upstreamnt  +downstreamnt
atgggaggaattaaattgaagtttaagagtattaagacaaaaatggctatatcctttgga
gtgttgattttaattatttgtataggacttggaacagtatcttttatagaatcttataac
acattagcttctaatgctactgagtctttatttcaaatggcagagcaatctgcaaagttt
gttgagactaaagttgaaggacaattagatgcaatggaggcattggcaggaaattactat
ataaagagtgataccttgcctgtagatcaaaagctaaatattttaaaagatgaagtgcag
agaagtggtcatataagcatgggcataggtgatgttagtggtaatgttatctttacagat
ggagtaaaggcaaatttatatgatagggaaaactataaacaagcacttcaaggtaagagc
tcagtttcagatcctgttttgggtaaagctgataatagacttgttatgtcttatgccgtt
ccaattaaggatggtggaaaagttaaaggagttttaattgctactcgtgatggaagtgaa
ttgagcaaattaacgcaaaatattaagtatggtaaaactggaacaacttttatgataagc
aaaagtggacataatgtagcaaataatgatatatcccttgtacgtaaaatggaaaatgta
attgagaaaagtaaaagcgatccaagcttgcaggagctcatgaaatttgaaggttatatg
atggaaggcaagagtggtgcagctggttatacatatagagatggaacaaaaaaatatatt
ggttatgcgcctgtaaaaggtaccaattggtcattaggaatatctgtacctaaatctgaa
gttatggaaagccttacgaaaaatgaaatactggagacagccactactattatattcgta
ttaataggtgtattaatagcattttttattacttcacttatagcaaaacctataaatgca
attacaaagcatttaaaaatagtagcatctggtgattttacgataccagtacctgaaaaa
ttgttaaaaatggaagatgaatccgggatacttgccactgcagtaaaggatatgcaggaa
agccagggaaacataattaaaaatataatagaacaatcttcaaatgtaactgaaaatatg
aaacaaatcaatatggaaatggagaatcttaataaaagtatagaagagatatcagcaact
acagaacagttatcggatacaacagagaaaactgctgaatctgctgaagaaataaatgac
atatcaaagacaatagaaaataatgcagaatctatatcacaaaaggctgagcatagttct
gaaagtgtttcaaaagcaagtaatatgtcagaagaaatgaagcaaaaggccataaaatct
agagagagtataatgagtatatacaaaaacacaaaagaaagtttggaaaatgctattaaa
gagtcaaaagaggtttccaagatcaatgaattatcttcagcaattcttgatattatggaa
aatactaatttactagcattaaatgcatctattgaagctgcaagagcaggagaagcaggt
aaggggtttgcagttgtagcagatgaaataaggagtctttctgatgattccaaagacact
gtaggtagaatacaggaggttactaaaaatattttagaagctgtaggaaatttatcatct
ggtgcttatgaaatattggaatttatagataaaaagattttgcctgattataatgaaatt
gtagtatctcatgaaaaatccagtaagaatttttcagatataagtgacatggtaacagac
tttagtactacttctcatgagcttctttcatcagttcaaaatgtatcaaaattgatggag
gaaatatctgatagtggaaatgaacaagcaagtggagctcaaaatattgcaggtgaaact
tcttacataactagaatgtcaggacatgttgtggaattaactgaaaaggcaaaagaaaaa
tctgattccttagtaaatacagtttcaaagtttaaagtgtaa

KEGG   Clostridium carboxidivorans: Ccar_10025
Entry
Ccar_10025        CDS       T03979                                 

Definition
(GenBank) hypothetical protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_10025
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_10025
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_10025
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_10025
SSDB
Motif
Pfam: dCache_1 MCPsignal dCache_2 GAT Laminin_I DUF948 HAMP
Other DBs
NCBI-ProteinID: AKN31167
UniProt: C6Q277
LinkDB
Position
2322862..2324856
AA seq 664 aa
MKSIKQNITLIISSICILSLLVLASVSYFISYNLIMNESKGKIIAQSGKYSEMINGWMDG
QGKIVKEIGGSIEEMDVNDNNKILEYLQKKTKDNPNTAGAYIGFKDKRYLDGSGWVPDKD
FDCTQRDWYKDAVKKNGLVYSQPYLDELTKKIVVSISKPIVKNNEIIGVVSCDIKLDTIT
NTLEKSKTINNSYAFLLDNKNNFIVHPNKDFQPAKDKSKNISTIMNGRFSKILNNQITLL
KDFDNKEKYFVNSKIDSCNWIVGIAVPKSELEKPLHSLLIGFILVIITVLVLSILFSLYI
GGKIANPIISLTKSVNKTSNLDLTSDNSCDYLLGRKDEIGQLANAAISMKSSIIELIKQV
KDESYIIEIIVNNIKEKMSNLNEDVTEVSSNTEELSAGMEETTASAEEMSAAAQEIGQAT
HIIAEKSQQGAVQAEKINERAAKTKENIQISQKKGFEIFANTTKELEISIKNSSVAEEIN
VLSDTIMEITEQTGLLALNASIEAARAGESGKGFAVVAEEIKELAEKSKDAASKIQNITN
KVIEAVKNLSQNSTNILKFMETDVINDYKSMITVADEYSNDAKFVESLVVGFSSTSQELL
ASISDVLKTIDGVTQSASEGTNEVVNISDKVLGINDNSNYILEQVLKAKECSDKLKIQIS
KFKI
NT seq 1995 nt   +upstreamnt  +downstreamnt
atgaaaagcattaaacaaaacataacattaattatctcatctatatgcatactaagttta
ttggtattagcttcagtaagttattttatatcttacaatttaataatgaatgaatctaaa
ggtaaaattattgcacaatcaggtaaatattctgaaatgattaatggatggatggatggt
caaggaaaaatagttaaagaaattggcggaagcattgaagaaatggatgtaaatgataat
aataagattttagaatatttacaaaaaaagacaaaggataatcctaacactgcaggtgca
tatataggtttcaaagacaaacgatatttagacggatctggatgggtacctgacaaagat
tttgattgtactcaaagggattggtataaagatgctgtcaagaaaaatggactagtttat
tcccagccttatttagatgaacttacaaagaaaatagtagtttctatatctaaacctata
gtaaaaaataatgaaataattggagttgtaagttgtgatattaaattagatacaattaca
aatacattagaaaaatcaaaaactataaataacagctatgcatttttattagataacaaa
aataattttatagttcaccctaataaagattttcaacctgctaaagacaaaagtaaaaac
attagcacaattatgaatggaagattttctaaaatattaaacaatcaaataactttatta
aaggattttgataacaaagagaaatattttgtcaatagtaaaattgattcttgtaattgg
attgttggtattgcagtacctaaaagtgaattagaaaaacccttacactcattacttata
ggatttattttagtaataattacagtattagtactttcaattttattttctttatacata
ggaggaaaaattgcaaatccaataatatctttaacaaaatcggtaaataaaacttctaat
ctggatttaacttctgataatagctgcgattatttattaggaagaaaagatgaaatagga
caacttgctaatgctgcaatttcaatgaaaagttcaattatagaattaataaaacaagta
aaagatgaatcatatataatagaaattatagtaaataatataaaagagaaaatgtcaaat
ttaaatgaagatgtaaccgaagtatcctcaaatacagaagaattatcagcaggtatggaa
gaaactactgcctccgctgaagaaatgtcagctgcagcacaagaaataggtcaagctact
catattatagctgaaaaatcccaacaaggtgcagtgcaagctgaaaaaataaatgaaaga
gcagctaaaactaaagaaaatatacaaatatctcagaaaaaaggttttgaaatatttgca
aatacaacaaaagaacttgaaatttctataaaaaattcaagtgttgcagaagaaataaac
gtactttcagatactattatggaaataacagaacaaacaggtcttttagctttaaatgca
tccattgaagctgcaagagcaggagaatcaggaaaaggatttgcagtagttgctgaagaa
attaaagaacttgcagaaaaatcaaaagatgcagcttctaaaatacaaaatataactaat
aaggtaattgaagcagtaaaaaacctttctcaaaattccactaatattttaaagtttatg
gagactgatgtaattaatgattataaatcaatgattacggtggcagatgaatatagtaat
gatgctaaatttgtagaaagtttagtagtaggttttagttctacctcacaggaactttta
gcatcaattagtgatgtactcaaaactatagatggtgtaacacagtctgcaagtgaagga
acaaatgaagtagtaaatatttcagataaagtacttggaattaacgataattcaaattat
atattagaacaagtgcttaaagcaaaagagtgttctgataaattaaaaatccaaatttct
aaatttaaaatttaa

KEGG   Clostridium carboxidivorans: Ccar_11335
Entry
Ccar_11335        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_11335
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_11335
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_11335
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_11335
SSDB
Motif
Pfam: 4HB_MCP_1 MCPsignal TarH HAMP WXG100 DUF1664 Mst1_SARAH DUF948 Laminin_II
Other DBs
NCBI-ProteinID: AKN31417
UniProt: C6PTW4
LinkDB
Position
complement(2583515..2585227)
AA seq 570 aa
MRIFNNLKMLYKLMTAFIIMVVFIGIVGFVGISNMKKINSNVSNLYNVDLKGVKDINMLK
TNLTTVKADVLQILDPKNSDKISSLVDDINKFQDINKKLVEEYKTTITTDTDKEQFAEFE
KLLEDYRNHRVKLIDRVKASDYNGANAIFPEVSKIREDMFAVLDKEIDLDTKLAANDYNN
SNAIFKSCTIVSMSIIGLAIIVAIILGILISIVISKRLSKILAFSQAIGQGDLTATIDID
SKDEIGNVAIALNQSRENIRGMVNEIMNDASDMSATSEELSATVEEVSSKMELVNESVEQ
ISRGVQDLSATTEEVSASTEEMNANTNELVNKANNSKISVDEIKERAITIKVKASKNIKE
STVMYNQNRSNILNAIEDAKIVEEVKLMADSISSIAQQTNLLALNAAIEAARAGEQGKGF
AVVADEVRKLAEQSKQSVENIQSMVCQVQKSVNELSQSGQEVLKFMESNVTPNYEFLQNT
GVQYEKDSEFMDNMAEDISASSKQMNEVIDQISDAMQSVSATAEESAASSEEISKSVNEV
TFAISDIAKSAQCQAELAQRLTDMVQKFKL
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgagaatttttaacaatttaaaaatgttatataagctaatgacagcttttataataatg
gttgtatttattggaattgttggttttgtaggaatatcaaatatgaagaaaatcaattca
aatgtttccaatttgtacaatgttgacttaaaaggcgtaaaggatataaatatgcttaaa
acaaaccttacaactgttaaagcagatgttttacaaattttagatcccaaaaatagtgac
aaaatttctagtttagttgatgatattaataaatttcaggatataaacaaaaagttagtt
gaagaatataaaactacaattactactgacactgataaggagcagtttgctgagtttgaa
aaattattggaggattatagaaatcatcgtgtaaaacttatagatagagttaaagcttca
gattacaatggtgctaatgctatttttcctgaagtttcaaaaattagagaagatatgttt
gctgtattggataaagaaatagatttagatacaaaacttgctgctaatgattataataac
agcaatgcaatttttaaaagctgtacaatagtttctatgagtatcataggattagctatt
atagttgcaattattttaggtatactgatatctattgtgatatcaaagcgattaagtaaa
attttagctttttctcaagctataggccaaggagatcttacagcaacaattgatattgat
tcaaaggatgaaataggaaatgttgctatagcattaaatcagtctagggaaaatataaga
ggcatggtaaatgaaataatgaatgatgctagtgatatgagtgcaacaagtgaagagttg
tcagcaactgttgaagaagtgtcatctaaaatggaattagtaaatgaatcagtagaacaa
atatccagaggagttcaagatttaagtgcaactacagaagaagtaagtgcatcaacggag
gaaatgaatgctaatacaaatgaacttgtaaataaagcaaataattcaaaaatatccgtt
gatgagataaaagaacgtgctattactataaaagtcaaagcttcaaaaaatataaaagag
agtacagtaatgtataatcagaatcgctcaaatattttaaatgcaattgaagatgctaaa
attgtagaagaggttaagcttatggctgattccattagcagtatagcacagcagacaaat
ttattagctttaaatgctgcaatagaggcagcaagggctggagaacaaggaaaaggcttt
gcagtagttgcagatgaagtaagaaagctggcagagcaatctaagcaatcagttgagaat
attcaaagtatggtttgtcaggtacaaaaatcagtgaatgaactttcacaaagtggacaa
gaagtacttaaatttatggaaagtaatgtaactccgaattatgaattccttcaaaataca
ggtgttcaatacgaaaaggattcggaatttatggataatatggcagaagatatttcggct
tcttctaaacaaatgaatgaagttattgatcagataagtgatgctatgcagagtgtatct
gcaactgcagaagaatcagctgcaagttcagaagaaatatcaaaaagtgtcaatgaagta
acttttgccattagtgatattgcaaaatcagcacaatgtcaggcagaacttgcacaaaga
ttaactgatatggtacagaagttcaaactttaa

KEGG   Clostridium carboxidivorans: Ccar_11365
Entry
Ccar_11365        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_11365
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_11365
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_11365
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_11365
SSDB
Motif
Pfam: MCPsignal dCache_1 HAMP DUF1664 AI-2E_transport DUF948 TMP_2
Other DBs
NCBI-ProteinID: AKN31423
UniProt: C6PTV8
LinkDB
Position
complement(2591083..2593173)
AA seq 696 aa
MKSLKSKIFLAIVICSVFTAILIGSISIFNSTNVAKTNSKEKLTLICEDKTNEINSKISK
IETSVNTLSQIVLEDLDDVDRFSSDAQYLQDYQNRIESVAKKFGENTDGAMTFYIRFNPK
ITPPTSGIFYSKENEKSNFKKLIPTDFSKYDPSDMEHVGWYYIPVNAKKATWMDPYLNSN
INVYMISYVVPIFKNGKSIGIVGMDIDFKNIQNIVKGTKIYDSGYAFLLNEKCDIIYHPK
INTKDNLSTIENGSLKSIKDEIIKNTSSNKLYSYTYKGIDKNLSYGHLSNGWVFVLTAPT
SEILKQSNGLIKIIGIFIIIGLILSGIVAFYLGNIISKPIVIITNIIKRAGNLDLTYDNN
LNNLLKHKDEIGQLSNAFNNMRREFETFVKEIVMRSQDMGISSKELSATAEKLTIKTENI
EKAVNNIANDVHETSVSAEEIKSSIQDVDSSINILSNKAAEGSNNANLSKVRAKDVQEKG
KLSIQETRKMYDEKKQKGLRAIEDGKIVENIKVMADTIASISEQTNLLALNAAIEAARAG
EQGKGFAVVAEEVRKLAEESSQAVANIQDTITKVQDAFKNLSDNNEDVLSFIHNNVDPQF
EIMGEVGNHYYKDAEFITSMSSEIAAMSEELMATINQVSEAVQSTAQIAQKSAENTETIK
DSINETVQSIQNLSQTAENQAEVAEKFNEMVQRFKI
NT seq 2091 nt   +upstreamnt  +downstreamnt
atgaaaagtttaaaaagcaagatatttttagctattgtaatatgttctgtttttactgca
atattaattggaagtataagtatttttaattcaaccaatgtagctaaaacaaattccaaa
gaaaaattaactttaatttgtgaggataaaacaaatgaaatcaattcaaaaatttctaaa
atagaaacatcagtaaacactctttctcaaatagtattggaagatttagatgatgtagat
aggttttcaagtgatgcacaatatctacaagattatcaaaatcgaatagaatctgtagca
aaaaaatttggtgaaaatacagatggagcaatgacgttttatataagatttaatcctaaa
atcacgcctccaacttccggaatcttttattccaaagaaaatgaaaagagcaattttaaa
aagttaattccaacagattttagtaaatatgaccctagcgatatggaacatgtaggatgg
tactatatacctgtaaatgcaaaaaaggctacatggatggatccatatttaaattctaat
attaatgtatacatgatttcctacgtagtacctatattcaaaaatggcaaatctattggt
atagttggtatggatattgattttaaaaacattcaaaacatagtaaaaggtacaaaaatt
tatgattcaggatatgcctttttacttaatgagaaatgcgatatcatatatcatcctaaa
attaatacaaaggataatttatcaactatagaaaacggatctctaaaatcaatcaaagat
gaaattataaaaaatacatcttctaataaactatattcctatacgtataaaggtatagat
aaaaatttaagttatggtcatctttcaaatgggtgggtatttgtgttaacagcacctaca
agcgaaattttaaaacaatctaatggtcttattaaaataataggtattttcattataatt
ggattaattttatctggaatagtggcattttatttgggtaatattatttcaaagcctata
gttataatcactaatattataaagagagcaggaaatcttgatttgacttatgataataat
ttgaataatttgctaaagcataaagatgagataggccagctttctaatgcatttaacaat
atgaggagagaatttgaaacctttgtaaaagagatagtaatgagatcacaggatatgggc
atatctagcaaggaactttctgctacagcagaaaagcttacaataaaaacagaaaatatt
gaaaaagcagtaaacaatatagcaaatgatgttcatgaaacgagtgtgtcagcagaagaa
ataaagtcatctatacaggatgttgattcaagtattaatatattatcaaataaagctgct
gagggaagtaacaatgcaaatctatctaaggtgagagcaaaggatgttcaagaaaaggga
aaattatctatacaagaaacaaggaagatgtatgatgagaaaaaacaaaagggattaaga
gctattgaagatggcaagatagttgaaaatataaaagttatggcagatactattgcaagt
atatcagaacaaacaaacttacttgcactaaatgcagctatagaggcagcaagagctggt
gaacaaggaaaaggatttgcggtagtggctgaagaagtaagaaaacttgcagaagaatca
tcacaagcagtagctaatatacaagatacaataacaaaagtacaagatgcatttaaaaat
ctttctgataataatgaagatgtattatcctttatacacaacaatgtagatccccagttt
gaaattatgggagaggttggaaatcattattataaggatgcagaatttataactagcatg
tccagtgaaatagcagccatgtcagaggagcttatggctacaataaatcaagtaagtgaa
gcagtacaaagtacagcccaaattgcacaaaagtcagcggaaaatacagaaacaataaaa
gatagtattaatgaaacagtacaatctattcagaatttatcacaaacagcagaaaatcaa
gctgaggttgctgaaaaatttaatgaaatggtacaacgttttaagatttaa

KEGG   Clostridium carboxidivorans: Ccar_11465
Entry
Ccar_11465        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_11465
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_11465
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_11465
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_11465
SSDB
Motif
Pfam: MCPsignal dCache_1 DUF948 Acid_PPase Laminin_II DUF3450 HAMP BLOC1_2 Snapin_Pallidin DUF745 DUF1664
Other DBs
NCBI-ProteinID: AKN31443
UniProt: C6PTT5
LinkDB
Position
2615588..2617597
AA seq 669 aa
MNSIKNRITFSMLLLIVLLLFCSSAGSYFISRNILVNQYSNKMSISSEKYSEIVNGWLDK
ETIKFKDIVDNMYDNNIIGDNNKLTDYFKQKLKANPNISDLYMGFTNKTHIDGSGWIPPS
DFDPTKRDWYKNAISKNGIVYVPYYDLVTKKMVVSISTTVSKDGVLLGVVSEDIKMDSIT
NVIEKAKPIENSYGYLIDDRNNVLVHPYKDLKPEKDKLKSLYDFMGGKYKTITEKNGQII
NMDDYDGINKYFSASKVNASNWTIGFAVPKSEFTKDLRSLIALNLIIFIICIVAAIIFSR
YVAIIISRPIDNIRHVIAQIGKLNFNYNANKLDSVINNRDELADIAVDIQSLSKTLTSVV
QDIKNSSYDVLEYSNSILHALNESSTSIEEISKTAEEMASDSVLQAGEANKGNEKLNDLS
DKINNIAGKANKFKEHFSNVKSINDNGILEIKSLNLKLNDNNKTVWEAARNMNDLAEKSK
SIVKIVDEIEAVSEQTNLLALNAAIEAARAGEAGKGFSVVAGEVRLLSEETKKSVTNISK
VVNEISEEIKTVLKNVESVAKTNTEVNESMEKSNESFNTMKKSMDEIILNIDGLFEKINQ
VDADKNLVVKSIESISSISEKSSEGSQELAASVEEQNNSIESINMSMKKLKGISEKLDDI
VGKFNLEDN
NT seq 2010 nt   +upstreamnt  +downstreamnt
atgaatagtataaaaaataggataactttttcaatgctgctattaattgttttattatta
ttttgttcatctgccggaagttatttcatatctagaaacatacttgtaaatcaatatagt
aataaaatgagtatatcatccgaaaagtattctgaaattgtaaatggatggcttgataag
gaaaccataaaatttaaagacattgtggataatatgtatgacaacaacataataggtgac
aataataaattaacagactattttaagcaaaagcttaaagcaaatcctaacatttcagat
ttatatatgggatttacaaataaaactcatatagacggatcaggatggattccgccatca
gattttgatcctacaaaaagagattggtacaaaaatgccatttcaaaaaatggaatagtc
tatgtgccttattatgatctggtaactaagaaaatggttgtatcaatatctaccactgta
tcaaaagatggagtattactaggtgtagtttctgaagatataaaaatggattctattaca
aatgtaatagaaaaagcaaaaccaattgaaaatagctatggttacttaattgatgataga
aataatgtattagttcatccctataaagatttaaaacctgaaaaggacaagcttaaaagt
ttatatgactttatgggtggaaagtataaaactattacagaaaaaaatggacaaatcata
aatatggatgattatgatggaataaacaaatacttttcagcttctaaagtaaatgcatct
aattggactattggatttgcagttcctaaaagcgaattcacaaaagatcttcgctcactt
atagcattaaacttaattatattcattatatgcatagttgcagctattatattttcaaga
tatgttgccatcataatatcaagacctatagataatataagacatgtaatagcacaaata
ggaaaattgaatttcaactataatgcaaataaattagatagtgtaattaataatcgagat
gaattagcagatatagcagtggatatacaatcactttccaaaactttaacttctgtagtt
caagatataaaaaacagttcttatgatgtgcttgagtattcaaatagtatattgcatgca
ttaaatgaatcctcaacatcaatagaagaaatatcaaaaacagccgaagaaatggctagt
gactcagttttacaagcaggtgaagcaaataaaggaaatgaaaaactaaatgatttatct
gataaaataaataatatagcaggtaaagcaaataaattcaaagaacatttttcaaatgta
aaaagtataaacgataatggaatattagaaataaaatcactaaatttaaaactaaatgat
aataataaaaccgtttgggaagcagcaaggaatatgaatgatcttgctgaaaaatccaaa
tcaatagttaaaatagtagatgaaatagaggcagtatcagaacaaactaacttacttgca
ttaaatgcagctattgaggctgcaagagcaggtgaagcaggaaaaggattttcagtagta
gcaggagaggttcgattgctttcagaggaaaccaagaaatctgtaactaatatttccaaa
gtagtaaatgaaataagcgaagaaataaaaacagtactaaaaaatgttgaaagtgtagcc
aaaactaataccgaagtcaatgaaagcatggaaaaatccaatgaatcatttaatacaatg
aaaaaatccatggatgaaattattttaaacatagatggcctgtttgaaaaaattaatcaa
gtagatgcagacaagaatttagttgtaaaatccatagaaagtatatcctccatttcagaa
aaatcctctgaaggaagtcaggagttagcagcttcagttgaagaacaaaacaattcaata
gaaagcataaatatgagcatgaaaaaactcaagggtatatctgaaaaacttgatgatata
gttggcaagtttaatctagaggacaattga

KEGG   Clostridium carboxidivorans: Ccar_12415
Entry
Ccar_12415        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_12415
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_12415
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_12415
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_12415
SSDB
Motif
Pfam: MCPsignal dCache_1 dCache_2 IFT57 DUF1664 Mce4_CUP1 Spc7 HAMP sCache_like GAT BLOC1_2 HAUS-augmin3 CENP-F_leu_zip
Other DBs
NCBI-ProteinID: AKN31624
UniProt: C6Q174
LinkDB
Position
2828014..2830008
AA seq 664 aa
MKSIKAKLILFVGLLIGVICISLGAISFINSTKSLQSNLSKTLPKIADQTASSVQGRVEG
QLNELEAIASMPEIRNVNNSWQNKSVILLEQAKRMGSMKLGIADKNGDTKSTDGSSTNVK
DREYYQKALSGKNNVSDPLIGKVSGSVEVKYVVPIKNNNEVVGVLIETRDGNALSELTNQ
VKVGTTGYAFMIKKDGTTIANVNKDLVMKMDNTIENAKKDNKLQPLADIIKKMGAGESGI
GQYNYSGVEKYVGYAPVKGTEWSVGVTVTNGEILSELNSLKVSVAAFSILFILIGLATVY
IIANSISKGIKSTSKHLGLLAEGNLCEEVSPKYLQLKDEVGDMTNSMKVMQESLKQMISR
IKDNSTSINMQSENLSSISEEIASSSQNVTEAINEIAKGTSSQSEDFINVTEILNDFSDK
LSGMVGEIQVVDSNSREISLMAKESSNEMNQLNQSVTKVSSSFKNFNGKISGLGKDVKEI
NEITNIINSIAEQTNLLALNAAIEAARAGESGKGFAVVADEIRQLAEQSKASSEEINRLI
NEIAKNTDVIVQDSVEMDDELINQVKIINSSIISFKKIIEAVNEVIPKIETVKTSAEGID
KDKETILSRVDDVSSVSLEVSASSEEISASSEEMNASTEEIAAAAQTLSNMTKGMIDEVN
KFKI
NT seq 1995 nt   +upstreamnt  +downstreamnt
atgaaaagtataaaggcaaagttaatattatttgtaggtttgttaataggagttatatgt
ataagtttaggtgcaatttcatttataaattcaacaaagtccctacaatcaaatttaagc
aaaacacttcctaaaattgcagatcaaactgctagcagtgttcaaggaagagttgaggga
cagctaaatgaattagaggctattgcatcaatgcctgaaataagaaatgttaacaattca
tggcaaaataaaagtgtaatacttttagagcaagctaaaagaatgggaagcatgaaatta
ggtattgcagataaaaatggtgatactaagagtaccgacggatcaagtactaatgtgaag
gatagagaatactatcaaaaggcattatcaggcaaaaataatgtatcggatccattgata
ggtaaagttagcggcagtgtagaggttaagtatgtggttcctattaagaataataatgaa
gttgtaggagtattaattgaaacaagagatggaaatgcattaagcgaactaactaatcag
gttaaggttggaacaacaggttatgcatttatgataaaaaaagatgggacaaccattgct
aatgttaataaagatttagttatgaaaatggataacacaattgaaaatgcaaaaaaagac
aataaattacagcctttagcagatattattaagaaaatgggagcaggagaatcaggaatt
ggccaatataactatagtggagtagaaaaatatgtaggttatgctccagtaaaaggaact
gaatggtctgtaggagttacagtaacaaatggtgaaatattatcagaattgaatagccta
aaggtttctgttgcagcattttctatattatttatattaattggattagcaacagtctat
attattgctaatagtatatctaaaggaataaaatcaacttcaaaacatctgggattatta
gcagagggtaatctatgtgaagaagtttcccctaaatatcttcaattaaaagatgaagtt
ggagatatgactaattcaatgaaggtaatgcaggaatcattaaaacaaatgattagccga
ataaaagataattctacaagtattaatatgcaatcagaaaacttatcctctatttcagag
gaaatagctagttcctcacagaatgttacggaggcaataaatgaaattgcaaagggtaca
agttcccaatctgaggatttcataaatgtaacagaaattcttaatgattttagtgataag
ttatcgggaatggttggagagatacaagttgtagactcaaattccagggaaattagttta
atggcaaaagaaagcagtaatgaaatgaatcaattaaaccaatctgtaacgaaagttagt
agttcatttaaaaactttaatggtaaaattagtggacttggaaaagacgtaaaggaaata
aatgaaattactaatataataaatagtattgcagaacaaacaaatttattagcattaaat
gcagctattgaagcagctagagcaggtgaatcaggaaaaggctttgctgttgtcgcagat
gaaataagacaacttgccgagcaatcaaaagcatcatcagaagaaattaatagattgatt
aatgaaatagctaaaaatacagatgttatagtccaggattctgttgaaatggatgatgaa
ttaataaaccaagttaagattataaacagttcaataatatcttttaaaaaaattatagaa
gcggtaaatgaagtaattcctaaaattgaaacagttaagacctctgctgagggtatagat
aaggataaagaaactatcttgagcagagtagacgatgtatcttcagtttctcttgaagtt
tcagcatcttcagaagaaatttctgcgtcctcagaggagatgaatgcttctacagaagaa
atagctgcagcagcacaaacacttagcaatatgactaagggaatgattgatgaagtaaac
aaatttaaaatttaa

KEGG   Clostridium carboxidivorans: Ccar_12625
Entry
Ccar_12625        CDS       T03979                                 

Definition
(GenBank) hypothetical protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_12625
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_12625
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_12625
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_12625
SSDB
Motif
Pfam: MCPsignal dCache_1 Cache_3-Cache_2 HAMP sCache_2 dCache_2 sCache_3_2 DUF948 Cation_ATPase_C Apolipoprotein
Other DBs
NCBI-ProteinID: AKN34169
LinkDB
Position
complement(2880397..2882346)
AA seq 649 aa
MLIMIVIGIAPIISLGIFSNIKTDSIVRNRFEVSTSQTIQEVNRGIENFFEGMSTPLIFM
DNNSYIKEIKTHPENVLILNSIFKDVKASNECIESVIFGLPDKTVYVYPESSNTLDPTTR
PWYIGAMAKRGKVFYSDPYVGLLTKKNLVTISMTVENNNQVIGVIGVTINLDKLSNKLSS
IKIGQKGYIYVTDSKGILVAHPDKKLIGTDTIKKLSIWEMAKNRESGFQKDNSKNANNII
IYDTNKLTNWKLFASMPNSEINDDLNYLKKYSIVFIFIMLVLSGIAALIVSRRITKNIFK
LQNAFNKAAYGDLSIRTDINSKDEFGKLGNDFNKMVEGIGTLICNVKESADILNENSDTI
TSMAKESDDAVKEVAATIGQIADGTSDQSMNVDEGVRELEQVSNKIYNISELTNKMSNES
ENTNRLSKKGLEVVKILTEKSVNTDKSTMDVNDIVLDVHKSSNEISVITDTINQISSQTN
LLALNAAIEAARAGEAGKGFSVVADEIRKLAEESTSATEQIQALVGSIRGKAQTAVKAME
ETKNSVKEQNSAVSETRTIFGEILTSINKLTSQIQLVKEKAEETINNKDEIVAKMQNISA
VSEEIAASTEEVSASGEEITATMDEFLTNANSLKQLSIELEAQINKFKL
NT seq 1950 nt   +upstreamnt  +downstreamnt
atgcttattatgatagttatcggtattgcgccaataatatctttaggcattttctctaat
attaaaactgacagtattgtgagaaataggtttgaagtttcaactagccaaacaattcaa
gaagttaatagaggcatagaaaacttttttgaaggaatgtctacacccttgatatttatg
gataataattcatatataaaagaaataaaaacacatccggagaatgtattaatattaaat
tctatttttaaggatgtaaaagctagtaatgaatgcattgaaagtgttatatttggattg
ccagataaaacagtatatgtatatcctgaaagtagtaatacactagacccaacaaccaga
ccttggtatataggtgccatggctaaaaggggaaaggtattttactctgatccatatgtt
ggtttattgaccaagaaaaatctggtgacaatttccatgactgttgaaaataataatcag
gtaattggagttataggagtaactataaatcttgataagttatccaataaactatcaagt
ataaaaattggacagaaaggttatatatatgtaactgattcaaagggtattctagtagct
catcctgataaaaagttaataggtacagatacaataaaaaaattgtcaatatgggaaatg
gcaaaaaacagagaatcaggatttcaaaaagataattctaaaaatgccaataatattatt
atttatgacacaaataaattgaccaattggaagttatttgcgtcgatgcctaactctgaa
ataaacgatgatcttaattatttaaaaaagtattcaattgtatttatttttataatgctt
gtactttcgggaatagcagcattaattgtgagcagaaggatcactaaaaacatatttaaa
ttacaaaatgcatttaataaggcagcctatggtgacttgtcaattcggacagatattaat
agcaaagatgagttcggaaaattaggaaatgattttaataaaatggtagaaggtatagga
acattgatatgtaatgttaaagaatccgctgatattttaaatgaaaattcagatacaata
acttcaatggctaaggaaagtgatgatgctgttaaagaagtggcagcaacaataggtcaa
attgcagatggaacttcagatcagtcaatgaatgtagatgaaggagttagagaattagaa
caggttagcaataaaatatataatatttctgaacttacaaataaaatgtctaatgaatca
gaaaataccaataggttaagtaaaaaaggattagaagtagttaaaattcttactgaaaaa
tctgtcaatactgataaatctacaatggatgttaatgatattgtattagatgtacataaa
tcatctaatgaaattagtgttattactgatactattaatcaaatatcatcacaaactaac
ttgttagcattaaatgctgcaatagaggcagcaagagcaggtgaggctggtaaaggattt
tctgtagtggcagatgaaattcgtaaacttgctgaagaatctacttctgcaactgaacag
attcaagcattagttggtagtattagaggaaaagcacaaacagcagttaaagcaatggag
gagacaaagaacagtgtaaaagaacagaatagtgctgtttctgaaacaagaactatattt
ggagaaatattaacttcaataaacaaattaacttcgcaaattcaattggtgaaggaaaag
gcagaagaaactattaataataaagatgaaatagtagctaaaatgcaaaacatatctgca
gtttcagaagaaattgctgcaagcacagaagaagtttcagcatctggggaagagattaca
gcaacaatggatgaattcttaaccaatgcaaattctttaaaacaattatcaatagaactt
gaagcacaaatcaataaatttaagttataa

KEGG   Clostridium carboxidivorans: Ccar_13475
Entry
Ccar_13475        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_13475
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_13475
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_13475
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_13475
SSDB
Motif
Pfam: MCPsignal dCache_1 sCache_3_2 dCache_2 sCache_2 Cache_3-Cache_2 HAMP GOLGA2L5
Other DBs
NCBI-ProteinID: AKN31821
UniProt: C6PT59
LinkDB
Position
complement(3081824..3083857)
AA seq 677 aa
MSIKKKIPFLIAIIIVVLMVVTTVFINNRSSNIIKNKTNSEIQQICDRSAETISSTIEKE
KLAVRIYSEKNVVRNLLKVNKDTPNSEDFNKQQQDMNLALQDYVKETKNLEHVFIVDTKG
NIVADSDKDYLGKNVNDRSYNKPSLEGKNSISEVIMSKVTNNPIVVFTNPVKLNNEILGY
VGTAVYGSSFSKYLTNAKASEFSSGYAFLMDYKGNMIYHPTKEKIGKPTETSEIKAITDR
LNKGETVKGSILNYNFKNVDKISGYQIIPETNWVIVTTSDKSEVLKDIKSMTNIIIIISI
LLSIIAIGIGYGFSLRITKPIGEIVNLIDKTANLDLENVENFDRLYNYNDEVGMMARSMG
NMRKVLREMVGDITSASAAISSNAELVDKLTIELKSYAEKTAEESENLSAGMEENAATVE
EVSASSDEMGNAVNSMAEKASGGSANANDIAGRAEKLKNVAFESDKKANEIYMSVKNDLE
KAIENSKSIEKINLLSADILDITEQTNLLALNASIEAARAGESGKGFAVVADEVGKLAEE
SAATASNIQNVVGQVVEAVQNLSDNSSKLLKFINETVLKDYSNLVKTGEEYNNDAETVNN
FMSDFSAVAEELSSSIAGITTAIGEVANTVSDGARGVTEIASKAASIDEKLGNIKSTSDN
NKQSADKLQQIISKFKI
NT seq 2034 nt   +upstreamnt  +downstreamnt
atgtctataaagaaaaaaataccttttttaattgcaataataattgttgttttaatggtt
gtaactactgtttttattaacaataggtctagcaatataataaaaaacaaaactaatagt
gaaatacaacaaatatgtgatcgttcagctgaaactataagttcaacaattgaaaaagaa
aagttggcagttagaatttattcagaaaagaatgtagttagaaatttacttaaagtaaat
aaggatactccaaatagtgaagattttaataagcagcagcaggatatgaatttagcacta
caagattatgttaaagaaactaaaaatcttgagcacgtctttatagtggatactaaagga
aatatagttgcagatagtgacaaagattatcttggaaaaaatgtaaatgataggtcttat
aataagccaagcttagaaggtaaaaattcaataagtgaagtaattatgtcaaaagtaact
aacaatcctatagtggtttttactaatccagttaaattaaataatgaaattttaggatat
gtaggtacagctgtgtatggcagcagtttttcaaaatatttaactaatgctaaagcaagt
gaattttcatctggctatgcatttttaatggattacaaaggaaatatgatttatcatcct
actaaagaaaaaataggaaagcctacagaaacttctgaaataaaagctataactgataga
ctaaataaaggggaaactgtaaaaggaagtatacttaattacaattttaaaaatgtggat
aaaatatcaggatatcagattatacctgaaacaaattgggttatagtaacaactagtgat
aaatcggaagtattaaaggatattaaaagtatgactaatattataatcattatatctatt
ttgctttcaattatagctataggaataggttatggattttcattaaggattactaagcct
attggtgaaattgttaatctcatagataaaacagctaatttagatttagagaatgttgag
aattttgataggttgtataattataatgatgaagtaggaatgatggctcgttctatggga
aacatgagaaaagtactaagggaaatggttggagatataacatcagcttcagctgcaata
agttcaaatgcagagttagttgataagctgaccattgagttaaagagttatgctgaaaaa
acagcagaggaaagtgaaaatctttcagcaggtatggaggaaaatgcagctacagtagaa
gaagtttcagcttcttcagatgaaatgggaaatgcagtaaattctatggctgaaaaagct
tcaggtggttctgctaatgccaatgatattgctggaagagctgaaaaattaaagaatgtt
gcatttgagtctgacaaaaaggctaatgaaatatatatgtcagtaaaaaatgatttggaa
aaagctattgaaaattctaagtctattgaaaagataaatttattgtctgctgacatactt
gacattactgaacaaacaaatttattggctcttaatgcttctatagaggcagctagagca
ggtgaatcaggaaagggatttgctgtagtggcggatgaggttggtaaactagcagaagaa
tctgcagcaacagctagtaacatccaaaatgtagttggacaggttgtagaagcagtacaa
aatttatcagataattcatcaaaacttcttaaattcatcaatgaaactgttttaaaggat
tatagtaatttggtgaaaactggagaagaatataataatgatgcagaaacagtaaataat
ttcatgagtgattttagcgctgtggcagaagaattaagttcatctattgcaggtataact
actgccataggggaagtagctaatactgtaagtgatggtgctaggggagttacagaaata
gctagcaaagctgctagtatagatgaaaagcttggcaatataaaatctacttctgataat
aataagcaaagtgctgataaattgcagcaaattatatctaaatttaagatttaa

KEGG   Clostridium carboxidivorans: Ccar_13740
Entry
Ccar_13740        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_13740
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_13740
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_13740
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_13740
SSDB
Motif
Pfam: HAMP_2 MCPsignal 4HB_MCP_1 HAMP Synaptobrevin DDDD Phi-29_GP4 SRP1_TIP1
Other DBs
NCBI-ProteinID: AKN31867
LinkDB
Position
complement(3142031..3145225)
AA seq 1064 aa
MNAMKWFYNMKISKKIIASITAIAVIGGLLIGSVGFIYINKINSLSKLIYKENITPLTPV
YRVEADFLKVRNNLRDMALSKSQDKSQYVNTINDLYKDLNNNLNEYSKYISSSEEDQNYK
VLKADVDKYAAVKDKMINLIQSNQLDGALALMNGDGSTITNELDTSITRAFDLNNKQADD
RNKMNVDNGSRAEMLMFGIVLLAVIMSVLIGLFVSKIISKPLNKILDAANSISSGNLNVD
LNIGSKDEVGILGQAFKKIVQSLENLITDSNMLAAAAVEGKLNTRVDASKHNGDYRKIVE
GFNSTLDSVIEPLNEANAILGKMSVNDFTVKMDTNQKGEFIKFADSINIVQRNLLNAEDI
FIKISKGDISRLDEFKRIGRRSENDKLMPAAIAVMESIQELIDETVTLSNNAINGSLSSR
ANAGKFQGGYKELVEGFNKTLEAIAEPINDSMVVLQKFSLNDYTVNMTKNYKGDFNTYAN
SINDLHKRLLVIQRAFNDTAKGDISQLEEIKRVGRRCENDQLLPALIEMMETNKNLFLEV
QMLTNNAIEGKLDVRGDSTKFKGNNKTIVDQINKLIDELNAPLKEANKVLNRMSLNDLSV
QMSGNYKGMLKEFSDAIEGVHQRLSSIQAIFIDISNGNTSRLEEFRKLGRRSENDRLLPA
IVRMMETIQELINESSLLVDAAVNGNLSIRGNADKFKGGYREVIQGINKTMDAVVRPIEE
ASNIMQKMAEGDLTFKMNEDYKGEYARMKDSLNFTISFFNDVLNEINNSASEVASGSRQV
SDGSQALSQGATEQASSVEQLTVSINEVAAQTKENAVNANQANELALKAKENAEQGNEHM
GEMLKSMEEINESSSNISKIIKVIDEIAFQTNILALNAAVEAARAGQHGKGFAVVAEEVR
NLAARSANAAKETTGLIEGSIRKVEAGTEIANATAKALNEIVGGVAKSANFVGEIASASN
EQAAAIAQINKGVEQVSQVVQTNSATAEESAAASEELSSQSQILKEMVSKFRLNSTSMKN
SAYEKNQYRNKENYMDDVDYSYAEAAVTSSKPRIALSDSEFGKY
NT seq 3195 nt   +upstreamnt  +downstreamnt
atgaatgctatgaaatggttttacaatatgaaaatttctaaaaaaattattgcctcaatt
acggctatagcagtaattggcggtttacttattggatcagtaggatttatatatattaat
aaaattaatagtttaagtaagttaatatataaagaaaatataacaccattaactcctgta
tatagagtagaagcggatttcttaaaagtacgtaataatttaagagatatggcattaagt
aaatcacaagataaatctcaatatgttaatacgataaatgatttatataaggatttaaat
aataatttaaatgaatatagtaaatatatatcttccagtgaagaagatcaaaattataaa
gtattaaaagctgatgtagataaatatgcagcagtaaaggataagatgattaatttgata
caatccaatcaattggatggtgccttagcattaatgaatggtgatggcagtactataaca
aatgaactggatacttccataacaagagcttttgatcttaataataagcaagctgatgat
cgaaataagatgaatgtagataatggaagcagagcagagatgttaatgtttggaattgta
ttattggcagtaattatgtctgtattaataggtttatttgtttcaaagataattagcaag
cctttaaataaaatattagatgcagcaaatagtatttcttctggaaatcttaatgtggat
ttaaatattggtagtaaagatgaagttggaattcttggacaagcatttaaaaaaattgta
caatctttagagaatttaataacagattccaatatgcttgcagcagcagcagtagaggga
aagcttaatacaagagtagatgctagtaaacataatggagactatcgtaaaatagtagaa
ggctttaacagtactcttgattcagtgatagaaccattgaatgaagcaaatgcaatttta
ggtaaaatgtcagtaaatgatttcactgtaaaaatggatacaaatcaaaagggagagttt
ataaagtttgccgattcaattaatattgtacaaagaaatttgctcaatgctgaagatatt
tttattaaaatttcaaagggtgatataagtagattagatgagtttaaacgaataggtaga
agatctgaaaatgataagttaatgccagcagcaatagctgttatggagtcaatacaggaa
ttaatagatgaaacagttactctttctaataatgctataaatggaagcttaagttcaaga
gcaaatgctggaaaattccagggtggatataaagaattagtagaaggtttcaataaaact
cttgaggcaattgcagagcctattaatgattcaatggtagttttacaaaagttttctctt
aatgattacacagttaatatgactaaaaattataaaggcgattttaatacctatgctaat
tctatcaacgatttgcacaagaggttattggtaatacaaagagcttttaatgatactgca
aagggagatattagtcaattagaagaaataaaacgtgtgggaagaagatgtgaaaatgat
cagctgctcccagcattaatagagatgatggaaacaaataaaaatttattccttgaagtt
caaatgttaactaataatgctattgaaggaaagctagatgttcgaggagattcaacaaaa
ttcaaaggaaataacaaaacaatagttgatcaaataaacaaactgatagatgaactgaac
gctcctttaaaggaggctaataaagttttgaataggatgtctttaaatgacttaagcgta
caaatgagtggcaactacaaaggcatgcttaaagaattttcagatgctatagaaggtgtg
catcaaagactttcaagtattcaggctatatttatagatatctccaatggaaatacatca
agattagaagaatttcgtaaactaggaagaagatctgaaaatgatagattgcttcctgca
atagtaagaatgatggaaacaatacaggaattaattaatgaatccagtttgcttgttgat
gcagctgtaaatggaaatttaagtataagaggaaatgcagataaatttaaaggtggttat
agggaagttattcaaggaattaataagactatggatgcagtagttagaccaatagaagaa
gcttcaaatataatgcagaaaatggcagaaggtgatttgacatttaagatgaatgaagat
tacaaaggtgaatatgctagaatgaaggattccttgaactttacaattagtttctttaat
gatgtattaaatgagattaacaattcagcatcggaggttgcttcaggatcaagacaggta
tctgatggaagtcaggcgttatctcaaggagctacggagcaggcaagttctgttgaacaa
ttaacagtgtccattaatgaggtagcagcacaaacaaaagaaaatgcagttaatgcaaat
caagcaaatgaactggcgcttaaggcgaaggaaaatgcagagcagggtaatgaacatatg
ggtgaaatgctcaaatctatggaggaaattaacgaatcatcttcaaatatttccaagatt
atcaaagtaatagatgaaatagcttttcaaaccaatatacttgctttaaatgcagcagta
gaagcagcaagggcgggacagcatggtaaaggctttgcagtagtagcagaagaggttaga
aatttggcagcaagaagtgctaatgcagctaaagaaacaacaggacttatagagggttct
attagaaaggtagaagctggtacagaaatagctaatgctacagctaaggctcttaatgaa
attgttggaggagtagcaaaatcagctaattttgtaggtgaaatagcatcagcttctaat
gaacaagcagcagctattgcacaaataaataaaggagttgagcaagtatcacaggttgta
caaacaaattctgctacagcagaagaaagtgcagcagctagtgaagaactttcaagtcaa
tctcaaatattaaaggaaatggtaagcaagtttagactcaatagtacttccatgaagaat
tcagcatatgaaaagaatcaatatagaaataaagaaaattacatggatgatgtagactat
tcatatgcagaagcagcagtaacctccagcaaacctagaatagctcttagtgatagtgaa
tttggtaagtattaa

KEGG   Clostridium carboxidivorans: Ccar_14425
Entry
Ccar_14425        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_14425
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_14425
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_14425
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_14425
SSDB
Motif
Pfam: MCPsignal 4HB_MCP_1 TarH T7SS_ESX_EspC IFT57 DP-EP DUF4199 T3SSipB CrgA SpoIIM KELK DUF948 T2SSF
Other DBs
NCBI-ProteinID: AKN31993
UniProt: C6PWS5
LinkDB
Position
complement(3296445..3298160)
AA seq 571 aa
MKINFNSFKNINITQGIIVMWLVSLITTIVIGVIGYVNTSRMHNNINDMYVNIIPKLKDW
GDVNGDMGVLRNTLTKIIDRPFEEQNEKTMISLNNDIRTIISRNEMSSKNDSEERQLVLQ
MKQAYEHYYSFIPKIIEQRKNNIIPDKQITNVAMGSYGNDLAKKNIQLIDYQKQKAKEQN
EKSKTLYYKNMTLFIIIFSISILVLTIISIIVIFIIKSSIKEFIDNLCRLSEGNFTVKFN
TKLTNEFGVMNKALEKTVISISNTISLIKKDSTNVTNQSISLTNISEQMRCYIEEVSASI
KEVTKGSSNQAEELVLINSNLNSFGEELDVIMKSINGIHNNAKNISDRSKKSDVELSKLA
SSINDIATSYDEARERINELTRSIEKITEIINLINDIADQTNLLALNASIEASRAGEAGR
GFSVVADEIRKLAEQSRSSSRDISNLLNTIEGEASLVTETTNNANNELIEQLTVISSNIV
SFREIITSIESILPQIQEMNKSIVQISSRKDHIISSVENSSLVAEENSQASQEISSSTEK
MTMSSDEVAKAAILLKDMMKKILQQVEKFTV
NT seq 1716 nt   +upstreamnt  +downstreamnt
atgaaaataaactttaatagttttaagaacataaatattacacaagggataatagtaatg
tggttagtatctttaataacaactattgttattggtgtaataggatatgtaaatacatca
agaatgcataacaatataaatgatatgtatgttaatattatacctaaactaaaagattgg
ggtgatgttaatggtgatatgggggttttaagaaatactctaactaaaataatagataga
ccatttgaagaacaaaatgaaaagacaatgattagcttaaataatgacataagaactata
atatctagaaatgaaatgtcgtcgaagaatgattcagaagaaagacaattggttttgcaa
atgaaacaagcgtatgagcattattattcttttataccaaagattattgaacaaagaaag
aataacataataccagataaacaaataacaaatgtagctatgggtagttatggaaatgat
ttggctaaaaagaatatccagctaattgattaccaaaagcaaaaggctaaagaacaaaat
gaaaaatctaaaaccttgtattataaaaatatgactttatttattattatttttagtata
tctattttagttttaactataatatcaattattgttatttttataattaaaagttctata
aaagaatttattgataatttatgcagattatctgaaggaaactttacagttaagtttaat
actaaacttactaatgaatttggtgtgatgaataaagcattagaaaaaacagttatatct
atttcaaatactatttctttaataaaaaaagattctacaaatgttaccaatcaatctata
tcacttacaaatatatcagaacaaatgcgttgttatatagaagaagtttcagcttcaatc
aaagaagtaacaaaagggtcttcaaatcaagctgaagaacttgtattaataaattcaaat
ttaaattcatttggtgaagaattggatgtaataatgaaatctataaatggaattcataac
aatgctaaaaatattagtgataggtcaaaaaaaagtgatgtggaattaagtaaacttgca
agttctataaatgatattgcaacatcttatgatgaggcaagagaaaggataaatgaactg
accagaagtattgaaaaaattacagaaataatcaatttaattaatgacatagcagatcaa
acaaatttacttgctttaaatgcatctattgaagcatctagggctggagaagcaggaaga
ggattttctgtggtagcagatgaaattagaaaattagcagaacagtcaagaagttcatca
agggatataagcaacttattaaatactatcgaaggtgaagctagtttagttactgaaact
actaataatgctaataatgagcttatagaacaacttacagtaataagtagtaatatagtt
tcttttagggaaataataacttccatagaaagtatactacctcaaattcaagaaatgaac
aaatctatagtacaaattagcagtagaaaggatcatattatatcaagtgttgaaaattca
tctttagtagcggaagaaaattcacaggcatctcaagaaatttcttcttcaacagaaaaa
atgactatgtcatctgatgaagttgcaaaagcagcaatattgttaaaagatatgatgaag
aaaattttacaacaagttgaaaagtttactgtataa

KEGG   Clostridium carboxidivorans: Ccar_14930
Entry
Ccar_14930        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_14930
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_14930
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_14930
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_14930
SSDB
Motif
Pfam: MCPsignal dCache_1 HAMP dCache_2 Nup88 sCache_2 DUF150 ZapB
Other DBs
NCBI-ProteinID: AKN32088
UniProt: C6Q2Q5
LinkDB
Position
complement(3407593..3409587)
AA seq 664 aa
MRTSLKNKLGLMFFVFIAIPLVVLGSFSYFRTSSLMQNTVEQQLEETTNQTAKLINENIN
SVNNYVQMLSLDGRLSSIASGDEKSSADVFNYLAQLQKQNSNQLEDVFITNASGKEVISS
EDEKPNVDLSDRDYVQNALKGNKNISQVITSKTTGKPVIVIAAPLKLNDKVTGIVGATIK
FEYISKYASQVKIGNDGYSYIVDKNGLIDYHPTSEKVLKENILNDNNDQLKTLFNKAKSG
QAAEGYYTYGGARKFVKFVPVSNWFIAVTADYKEYMSPAATIRKFTILIAVLSVIIALFL
AYKLTVRNIINPIKYLEGLMTKAGDGDLTVRAEINTKDEIQTLGEYFNKMIDHQDNTIHH
IREASESLTASSEELAASNEEISSTTEQIANTIEQVAQNSQAQSDSVVEVSEVLVQLSSL
VQISQSRAVTAKKNSEHTMDSAEQGRNKIEETVSAIENISEASAETENTLKVLQELSKKV
SGIISTINNISSQTNLLALNAAIEAARAGEHGKGFTVVAEEVRKLSEETNVGANEVSSLI
GEMVAKIGKAVDSMSLSKNAVENGVNIVKDTDKSFVSIIDAVKQISKDIEQIVDVTKDEV
ATSDKIINLINTVATATENNAANSEEVAASAEEQNSAIENVAASAQESSALAISLNNLVE
KFIV
NT seq 1995 nt   +upstreamnt  +downstreamnt
atgaggacgagtttaaaaaacaagttaggtttgatgttttttgtatttatagctattcct
cttgttgttttgggaagtttttcgtattttagaacttcaagtttaatgcaaaatacagtt
gaacaacaattagaggaaactacaaatcaaacagctaaattaataaatgaaaatataaat
tcagtaaataattatgttcaaatgttaagtttagatggtaggttatctagcattgcaagt
ggtgacgagaaaagtagtgctgatgtttttaactatttagctcaattacaaaaacaaaat
agtaatcaactagaggatgtattcattacaaatgcttctggtaaggaagttataagtagt
gaagatgaaaaacctaatgttgatttaagtgatagagattatgtacaaaatgctttaaaa
ggaaacaagaacataagtcaggttataacatctaaaactacaggaaaaccagtaatagta
attgctgctccattaaaacttaatgataaagttacaggtatagtaggcgctactattaaa
tttgaatatatttcaaaatatgcttcacaagtaaaaataggaaatgatggttatagctat
atagtagataaaaatggtttaattgattatcatcctacaagtgaaaaggtacttaaggag
aacattttaaatgataataatgatcagttaaaaactttatttaataaagctaaatcggga
caagctgcagaaggatattatacttacggtggagctcgaaaatttgtaaaatttgttcct
gtcagcaattggtttatagcagtaactgctgattacaaggaatatatgtctcctgctgca
actatcaggaaatttactattttaatagctgtattatctgtaattattgcattattttta
gcatacaaacttactgtaagaaacataataaatcctattaaatacttagaaggtttaatg
acaaaggctggagatggagacttaacagtaagagctgaaataaatacaaaagacgaaata
caaactttaggtgaatattttaataaaatgattgaccatcaagataatacaatacatcat
attagagaggcatctgaaagtttaacagcatcttctgaagagctagcagcttcaaatgaa
gaaataagttctacaacagaacaaatagcaaataccatagagcaggttgcacaaaattct
caagctcaaagcgattcggttgtagaagtatcagaagttttagttcaactatcaagctta
gttcaaatatcacaaagtagagcagttacagccaaaaaaaattcagagcatactatggat
agtgcagaacaaggaagaaataagattgaagagacagtttcagctattgaaaatattagc
gaagcatcagctgaaacagaaaatacactaaaggttttacaagaactttctaaaaaagtc
agtggaataattagtactataaataatatttcatctcaaaccaacttattggcattaaat
gcagctattgaagcagctagagctggagaacatggaaagggatttactgtagtggcagaa
gaagttcgtaaactttcggaggaaactaatgttggtgcaaatgaggtatcttcattgata
ggtgaaatggtagctaaaataggaaaagctgtagacagtatgagcttaagtaaaaatgca
gtagaaaatggagttaacatagtaaaagatacagataaatcttttgttagtattatagat
gctgtaaaacaaatatcaaaagatatagagcaaatagtagatgttacaaaggatgaagtg
gctacatctgataagataataaatcttattaatacagttgcaactgctactgagaataat
gcggctaatagtgaagaggttgctgcatcagcggaagaacaaaattcggcaattgaaaat
gtggctgctagtgctcaagaatctagtgcattagccatatcattaaacaatcttgtggaa
aaatttatagtttga

KEGG   Clostridium carboxidivorans: Ccar_15325
Entry
Ccar_15325        CDS       T03979                                 

Definition
(GenBank) hypothetical protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_15325
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_15325
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_15325
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_15325
SSDB
Motif
Pfam: MCPsignal Syntaxin_2 EspB ParB T7SS_ESX_EspC DUF1664 Mod_r Sec8_exocyst Occludin_ELL
Other DBs
NCBI-ProteinID: AKN32155
UniProt: C6PWY1
LinkDB
Position
complement(3493722..3494759)
AA seq 345 aa
MKNVCKKVGCFFRTIIGNHKLQDIDESDAKIDSNIRKENLNNIKDVSCKVKENTSNVKML
ISEIQESANNNLNISEKLTEEISDISDKAKEMSSSIKEIEKLTSLIADKSSESCENVHIV
NNESKNLKNQILQSIEGSKVMLDKIKSDLNDSIENSKEVEKIYTFSDDIIKITKQTNLLA
LNASIEAARAGEAGKGFNVVAGEVRKLAEESEKIAKNINGVINNVSSSVKNLSRCSYEVM
DYLSKVVNKDYDKYMKVCEQYDKEIINFSNIMNEVSDSTEKINVSVEDITNVVDRVANTI
SKSSDNVTEMSFDILNTVDKVFEVQNKVEFSEEEIGKLNSLIQDI
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgaaaaatgtatgtaaaaaagtaggttgtttttttagaacaattattggaaatcataaa
ttacaggatatagatgaaagtgatgctaagattgatagtaacattagaaaagaaaattta
aataacataaaagatgtttcttgcaaagttaaagaaaatacttctaatgtaaaaatgctg
attagtgaaatacaagaatctgcaaataataatttaaatatatctgaaaaattaactgaa
gaaatttcagatatatctgataaggcaaaagaaatgagctcgtctataaaagaaattgaa
aaattaacatctctaatagcagataaatcttcagagagttgtgaaaatgttcatatagta
aataacgagtcaaaaaatttaaaaaatcaaattttacagtccatagaaggttctaaggtt
atgttagataaaatcaaaagtgatttaaatgattcaatagagaactcaaaagaagtggaa
aaaatatatacattttcagatgatattataaaaataacaaaacagacaaatcttttagct
cttaatgcatccattgaggctgcaagagcaggggaggcaggcaaaggctttaatgttgta
gctggagaagttagaaaactagctgaagaatcagaaaaaattgcgaaaaatattaatggt
gtaattaataatgtaagttcttcagttaaaaatttaagtaggtgttcctatgaagttatg
gattacttaagtaaagttgtaaataaggactatgataaatatatgaaggtttgtgagcaa
tatgataaagaaatcataaatttcagtaatattatgaatgaagtaagtgattcaacagaa
aagataaatgtgtcagtggaagacataacaaatgttgtagatagagttgccaatactata
agtaaatcttctgataatgtaactgaaatgtcttttgatattttaaacactgtggacaag
gtatttgaagttcagaataaagtggaatttagtgaagaagaaattggaaaattaaattct
ttgattcaagacatttaa

KEGG   Clostridium carboxidivorans: Ccar_15685
Entry
Ccar_15685        CDS       T03979                                 

Definition
(GenBank) hypothetical protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_15685
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_15685
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_15685
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_15685
SSDB
Motif
Pfam: MCPsignal dCache_1 DUF1664 HAMP Cbl_N DUF3557
Other DBs
NCBI-ProteinID: AKN32223
UniProt: C6PUI2
LinkDB
Position
complement(3566461..3568479)
AA seq 672 aa
MEKNTRILKIKSFRTKLIIFAVVTSLLNICVLGSVMSTQVYSEMKSNQNSNVDNILSRYT
TYLDQFFGDNEASLNQFAENYYLKNILADPQNNSAKMISLFKDFQNSHPLVQLISYGTET
GQYYFDPARNSVPTGYDPRKRPWYIQAKATDNIAYTAVYADANTGKNILTIVKKIKNDNN
EMVGVLGIVIRLDTLNKINSGYKIGEKGYTFITQGENYLVHNNKDLINKKITEQKMHDLS
VGKTNSTFNDTSVEKGKNETRHIKCTYYPRTGWTIWSVGYNSDLLAPVYKILYKILFLSL
FLLVLTIILSIVVSKIMMNNINKILEATNIMSEGNMTHELVLKSGDEFQLLAQGVEAARK
GTKGLIENVNQITDKVLNTSSSLVLTAKQTAVAAEEVSGAIASIAISSTDQVQETEKISV
SIKNFSEKLDVMTEDFSFVNESVNKIKKQVTTGVDNMCVLNIKAKENIQLTCKIENMVNH
LASDIKNIDKILAAIKVISEQTNLLALNASIEAARAGEAGRGFSVVADEIRKLAESSAEF
TQKIKEITDMIQQDSIHTVNYMRNLKQSAEEQTGAVENANSTFNFISDSIKGIGKSVNLT
FENVKIIDDNKNKILEAVNTITANSEENAASIEQVSASSEEQTASASVVTSNAVDLENYI
NDLRKSLDNFKI
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggaaaagaatacaagaatattaaaaattaaaagttttagaacaaaactgataatattt
gcagtagtgacttctttgttaaacatatgtgtcctaggcagcgttatgtctactcaagta
tatagtgaaatgaaatccaatcaaaatagtaatgttgataatatattgagtaggtataca
acctatttagatcagttctttggtgataatgaagcttctttaaaccaatttgctgaaaac
tactatctaaagaatattttagcagacccacagaataattctgctaagatgattagttta
tttaaagattttcaaaattctcatcctcttgtacaacttatttcctatggaacagaaacg
ggtcaatactactttgaccctgctaggaattcagtacctacaggatatgatccaagaaaa
aggccctggtatatacaagctaaggcaacagataatattgcatatacagcagtttatgct
gatgctaacactggtaaaaacatattgaccattgttaaaaaaataaaaaatgataacaat
gaaatggttggtgtattgggaattgttatacgattagatacactaaataaaataaatagt
ggctacaagataggagaaaaaggttacacgttcataactcaaggggaaaattatcttgtg
cataataacaaagatttaattaataaaaaaattacagagcagaagatgcatgatctttct
gttggaaagacaaattccacatttaatgatacaagtgttgaaaagggaaaaaatgaaaca
agacacataaaatgtacctattatccgagaacgggttggactatctggagtgttggatat
aattctgatcttttagcacctgtatataaaatactttataaaatattgtttttatcctta
tttttattagtgcttacaataatattgtcaatagtggtaagcaaaataatgatgaataat
attaataagatactagaagctacaaatatcatgagtgagggaaatatgactcatgaatta
gttttaaaatctggagatgagtttcaattgcttgcacaaggtgttgaagcagcaagaaaa
ggaactaagggtttaatagaaaatgtaaatcaaattactgataaagtacttaacacgtca
tcatcattagtattaacggcaaaacaaaccgctgttgctgctgaagaagtttcaggtgca
atagcaagtatagctatcagctctacagatcaggttcaagaaacagaaaagatttcagta
tcaattaaaaatttttccgaaaaactagatgttatgacagaagatttttcttttgtgaat
gaatctgttaacaagattaagaaacaagtaactactggtgtggataatatgtgcgttctt
aacatcaaagctaaagaaaatattcagttaacttgtaaaatagaaaatatggtgaaccat
ttagctagtgatattaagaatatagataaaattttggcagcaataaaagttatttcagaa
caaactaatctattggcattaaatgcttcaatcgaggcagcaagagcaggagaagcaggt
agaggctttagtgtagtggctgatgaaataagaaaactagctgaaagttctgcagagttt
acacaaaaaattaaagaaattactgatatgattcaacaagattctattcatacagttaat
tatatgagaaatttaaagcaaagtgcagaagaacaaactggagcagtagaaaatgctaat
agcaccttcaatttcattagtgattctataaagggaataggaaaaagtgtaaacttaaca
tttgagaatgtaaaaataattgatgataataaaaataaaatattagaagctgttaatact
attacagcaaattcagaagaaaatgcagcatctatagaacaagtaagtgcttcgtcagaa
gaacaaactgctagtgcaagtgtagtaacctctaatgctgttgatttagaaaattatata
aatgatttaagaaaatctcttgataattttaaaatataa

KEGG   Clostridium carboxidivorans: Ccar_16380
Entry
Ccar_16380        CDS       T03979                                 

Definition
(GenBank) hypothetical protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_16380
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_16380
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_16380
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_16380
SSDB
Motif
Pfam: MCPsignal HAMP 4HB_MCP_1 DUF812 Lzipper-MIP1
Other DBs
NCBI-ProteinID: AKN32354
UniProt: C6PSY8
LinkDB
Position
complement(3716946..3718658)
AA seq 570 aa
METKDKLYSKNSFKGSLKMRMITGFVIIIMLMGLLSIVPFIVMKSNTDKMNTMMETTIVA
NEIIDYADDTGNVIEKYMTDKKDDQKQSCMNNLSKMNNAVAILKKNVKDKEGKKALDSLQ
RIVKTYNERITKTIELNDGKNFNAAMKKKEDAIETIDLMKSSSTDFIFTELKYYKGLKQE
LNVKYNTAKATVLILILAIGILSIIGASIFSGNIANIIYKLADSAKSIADGNLGIKEIKV
KSKDDLSVLAESFNKMSENLRSVIKSIADNSNKVSNSSETLKLNVEQNYSTVEQVAVSIQ
QVSEGAAKQAEECEKTVKVVNELYDKNKNIQENTNNVLETSVNAVEAANDGEKKVDSLIE
QINVIENKISKIEKNTEDLKNGSNEIKEIVDLIQSISTETNLLALNAAIEAARAGEAGKG
FAVVAEQVRNLSMDSAEAAKQIEEKVKNIQLQSEQVVGLMSEGVKEVREGTRLAHTAKES
FKKILSTSDNVGVEIKRIADEIINMVNDINNVEVMSKNIYDISKKTSGGSHEVAAAIEEQ
TASLEEMNSYATILSNMAGELDKIINQFKI
NT seq 1713 nt   +upstreamnt  +downstreamnt
atggaaacaaaggacaagttatatagtaaaaatagttttaaaggttctctaaaaatgaga
atgattacaggttttgttattataataatgcttatgggacttcttagtatagttcctttt
atagtcatgaaatcaaatacagataagatgaatactatgatggaaaccactatagtagct
aatgaaattattgattatgcagatgatactggaaatgttattgaaaaatacatgaccgat
aaaaaagatgatcaaaaacaaagctgcatgaacaatttatctaaaatgaataatgctgta
gccatattaaagaaaaatgttaaggataaagagggcaagaaagccttagattcattacaa
agaatagttaaaacttataatgaaagaatcacgaaaactattgaattgaacgatggtaaa
aattttaatgcagcaatgaagaaaaaagaagatgcaatagaaaccatagacttaatgaaa
agcagttcaacagattttatttttacagaattaaaatactataagggtttaaaacaagaa
ttaaatgtaaaatacaatactgctaaagcgaccgtattgatattgattttggctattggt
attttaagtattataggtgcttcaattttttcaggcaacatagcaaatattatatataag
cttgcagatagtgcaaagtctatagcagatggaaatttaggaattaaagaaataaaagtc
aaatctaaggatgatttatctgttcttgcggagtcctttaataagatgagtgaaaattta
cgttctgttataaaaagtattgcagacaatagtaataaagtatcaaattcttcagaaacc
ttaaaattgaatgtggaacaaaattattcaacagtagaacaagtagctgtttccattcag
caggtttcagagggggcggcaaagcaggcagaagaatgtgagaaaactgtaaaagttgta
aatgaattatacgataagaacaaaaacattcaagaaaatacaaataatgtgctagaaact
tcagtaaatgctgttgaggcagctaatgatggagagaaaaaggttgattccttaatagaa
cagataaatgttatagaaaataaaatttctaaaatagaaaaaaatacggaagatttaaag
aatggttcaaatgagataaaagagatagtagatttaatacaaagtataagcacagaaact
aatcttttagctttaaatgcagcaattgaggcagctagagctggagaagctggaaaggga
tttgcagttgttgcagagcaggtgagaaatctttctatggattcagcagaggcagcaaaa
caaattgaagaaaaggtgaaaaatatacaacttcaatctgaacaggtagttggtttaatg
agtgaaggggttaaagaagtaagggaaggtacaaggcttgcccatacagcaaaagaatct
tttaagaaaatattaagtactagcgacaatgttggggtggaaataaaaagaattgctgat
gaaattataaatatggtaaatgatataaacaatgtagaggttatgagtaaaaatatttat
gatatttcaaagaaaacttcaggaggaagtcatgaagttgcagcagccattgaagaacaa
acggcaagtttggaagaaatgaattcttatgccactattttgagtaatatggctggagaa
ctggataaaattataaatcaatttaaaatttaa

KEGG   Clostridium carboxidivorans: Ccar_17645
Entry
Ccar_17645        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_17645
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_17645
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_17645
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_17645
SSDB
Motif
Pfam: MCPsignal Sec8_exocyst
Other DBs
NCBI-ProteinID: AKN32572
UniProt: C6PSH1
LinkDB
Position
complement(3969778..3970737)
AA seq 319 aa
MNIFRNKKIKDLENKQVRDSEEAIKKTKQLQDGTNNFFQKMSKLLNETVKQHHMVDDQHD
VLGKLADEVKVHMSEISSLTENTNGLTDKLYSEGNNLIEITKDTVKKSYEGKNAIEEIVE
IVKSLENENRNNTENINELARRFSKVNEVVQLITNIANQTNLLALNAAIEAARAGEQGKG
FAIVAGEIRNLAEMTKQSTKDISELIGNIEDETKSVINNSDKSKEVIAKGVNASGNAAEK
IEESLSSIAKVEQEVREVMEILINQKQHIESMSKEIISVDEILKITSKTIINHIEEASIV
DKKLEETKTQLESYGKRVI
NT seq 960 nt   +upstreamnt  +downstreamnt
atgaacatatttagaaataaaaaaattaaggatttagagaataagcaagttagggatagt
gaagaagcgataaagaagacaaaacaattacaggatggaactaataatttttttcagaag
atgagcaaattgttaaacgaaactgtaaaacagcaccacatggtagatgatcaacatgat
gttttaggaaagcttgcagatgaagtaaaggtacatatgagtgaaatttctagtttaaca
gaaaatactaatggcttgacagataaattatattcagaagggaataatcttatagaaatt
acaaaagatacggttaaaaaatcatatgaagggaaaaatgctattgaagaaattgtagaa
atagtaaagtctttagagaatgaaaatagaaataatactgaaaacataaatgaattggca
agacgatttagtaaagttaatgaagttgtgcagttaataacgaatatagcaaatcaaaca
aatttattggctttaaatgccgcaatagaagcagcaagggcaggagagcaaggaaaaggt
tttgctatagttgcaggtgaaataagaaacctagcggaaatgactaaacaaagtactaag
gatatttctgagttaataggcaatatagaagatgaaacaaagagtgttataaataattct
gataaatctaaagaagttattgctaaaggggttaatgcttcaggaaatgcagcagaaaaa
atagaagaaagcttatcttctatagcaaaagttgagcaggaagtaagagaagtaatggaa
attttaataaatcaaaaacagcatattgaaagcatgagtaaagaaataataagtgttgat
gaaatattaaaaataacatcaaaaactataataaatcatatagaagaggcaagcattgta
gacaaaaaattggaagaaacaaaaacacaattagaatcttatggtaagagggtaatataa

KEGG   Clostridium carboxidivorans: Ccar_23375
Entry
Ccar_23375        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_23375
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_23375
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_23375
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_23375
SSDB
Motif
Pfam: MCPsignal 4HB_MCP_1 HAMP RIFIN TarH Sec34 DUF4064
Other DBs
NCBI-ProteinID: AKN33600
UniProt: C6PNB3
LinkDB
Position
5192662..5194374
AA seq 570 aa
MNFFRNLKIAHKISFLATSFLVFLLIMGVASVKQLSLVNIGIKELSESRMGPIVKLENMK
SNVEYIRTRSSALMDASDENTKNTIKSDVANKVASIDKSLSEYKSHADYKTLLDNYDKFI
AAKDEFMKTAGQQGAISAANGSSGPNDAASFDKAKTALTASFDEIINNHVKAANNTYDQS
KKIFGTTMIVIISLSLICLIITLILSIIIIKETVDPIRRVTKKLKEISESDGDLTQRIGY
DSKDEMGDLSRSFDLFMDKLHSIIKQVSVSAESMTSLSENLSDATTATTQSLDSIAGTVS
EISSSTSDGAAVSEETSASLAEVAKFSESTSVATKNTSVNSKKAKEIAEEGAGKISEIVS
SITDIASSSKEVSMIISDLDVSSKRIGEIIQIITGISAQTNMLALNAAIEAARAGEAGKG
FSVVADEIRQLADESNNAATQISELVKENQLKSASAVTSFEQVEGKVSHGVTKASEVGES
IQSIIHNIQDIVNQIEQINSANEQQAKSTKEIEMAINTIASSSSEIAGGTENISASIEEQ
LSTMNEIEKNTKNLSEMSKKLTKMTSGFKV
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgaatttttttagaaacttaaaaattgcgcataaaatcagtttccttgcaactagtttt
cttgtttttctattaataatgggggttgcttcagtaaaacaattgtctttagttaatatt
gggattaaagaactaagtgaatcaagaatgggtccaattgttaagttagagaacatgaaa
tcaaatgtggaatatattcgaactagaagtagtgcgttaatggatgcaagtgatgaaaat
acaaaaaatactataaaaagtgatgttgcaaataaggtagcatcaattgacaaatcatta
tcagaatataaaagtcatgctgattacaaaactttattagataattatgataagtttata
gcagcaaaggatgaatttatgaaaactgctggtcaacaaggagctataagtgcagctaat
ggtagttcaggacctaatgatgctgctagttttgataaagctaaaactgcattaactgca
tcctttgatgaaattataaataatcatgttaaagcagcaaataatacttatgatcaaagt
aaaaagatttttggtactacaatgattgtaataatatcactttcattgatatgtttaatt
ataactttgattttatctataattataataaaagaaactgttgatccaattagaagggtt
actaaaaaactaaaagaaatttctgaaagtgatggtgatttaactcaaagaataggctat
gatagtaaggatgaaatgggagatttgagcagaagttttgacttatttatggacaaactt
cattcaattattaaacaagtatcagtttcagctgaatctatgacatccttaagtgaaaat
ttaagtgatgcaacaacagcaacaacacagtcgttagatagtatagcaggtactgtttca
gagatatcctccagtacatcagatggagctgctgtttcagaagaaacttcagcgagtctt
gcagaagtagctaaattttctgaatcaacttctgtagcaacaaagaatacttctgtaaat
agtaaaaaggcaaaagaaatagcagaagaaggagcaggaaaaatatctgaaattgtttct
tctataacggatatagcttcttcatcaaaagaagtatcaatgattataagtgatttggat
gtatcttcaaagagaataggagaaattattcaaataataacaggaatttcagctcaaaca
aatatgttagctttaaatgcagccatagaggcggctcgtgcaggtgaggctggaaaaggc
tttagtgtagtagccgatgaaattagacagcttgcagatgaaagcaataatgcagcaaca
caaatatctgaattagttaaagaaaatcaattgaaatcagcctctgctgtaacatcattt
gaacaggttgaaggaaaggtgtctcacggagttactaaagcgtctgaggttggagagagt
atacaaagtataatacataacatacaagatatagtaaatcaaatagaacaaataaatagt
gccaatgagcagcaggcaaagagtactaaagaaattgaaatggctattaatactatagct
agcagttcaagtgaaatagctggtggtactgaaaatataagtgcaagcatagaagaacag
cttagcactatgaatgagatagagaaaaatacgaaaaatttatcagagatgtcaaagaaa
ctaactaaaatgacatctggattcaaagtgtaa

KEGG   Clostridium carboxidivorans: Ccar_23505
Entry
Ccar_23505        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_23505
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_23505
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_23505
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_23505
SSDB
Motif
Pfam: MCPsignal dCache_1 Bac_export_2 EI24
Other DBs
NCBI-ProteinID: AKN33625
UniProt: C6PN84
LinkDB
Position
5227556..5229259
AA seq 567 aa
MKNKIISFSITLFLTILLITGFTISYVSQNMLRSILLSKLGSSDQVNSILSQFNSKSIFI
VLISMLICALILSVIIAMFLNSIFIKIDKLKYDLNKISQGDLSIKLKSKGYMSTLADSIN
IMVGNTRKILCEIAEMSQKTRELSSNLNKNTKQTLSSSNEITKSIIAISESASVQSGNAE
STGESAKQMVSNAEIIAEHAGNTENIAKEMMNVINESVKVFDEIIVKIKGTGDVSEKLAN
NVETLQGEADAIKGIATVVTEISEQTNLLALNASIEAARAGEHGKGFAVVADEVKELAEQ
SSSSAEEITKIIDNITLKIAQITKEANEQAESTKDDIKFADGSKNSFSKIKESTSSTYDA
INEIHKLASQTSLMSDKVNELINGIILANEESVAFTQEVSASAQEQSASMESLSELIKNM
NDAADSVDLKLKDFINNIEIGENEKNSIKSGFLNLKNINEEINSKALPMDGVSQLLKEKE
NLYKEFEYIGVMDKKGIMKSASKPISSENNNYSFRPYFKEAMKGNEYYTEPYISNVSFNY
CIAIAVPFKNKFGEIDGVIMADLIIEK
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgaaaaataaaataatatcattttctataacgttattcctaactatattattaataact
ggttttacaatatcttatgtttcacaaaacatgcttagaagtatacttttatccaagtta
ggtagtagtgatcaagtaaattctatactatctcaatttaattctaaaagtatatttata
gtgcttatttctatgttaatatgtgcattaatattatcagttataattgcaatgttttta
aacagtatatttataaaaattgacaaattaaaatatgatttgaataagatatcacaagga
gatttatctataaaattaaaatctaagggatatatgtctactttagcagacagtataaat
attatggtagggaatactagaaaaattttatgcgaaatagcagaaatgtctcaaaaaact
agagagttatctagcaatttaaataagaatacaaaacaaactttatcatcatcaaatgag
ataactaaatctataattgcgattagtgaatcggcttcagtacaatcaggaaatgcagaa
agtacaggagaaagtgcaaagcaaatggtaagcaatgctgaaattatagctgagcatgcc
ggaaatactgaaaacatcgcaaaagaaatgatgaatgtaattaatgaaagtgttaaagtt
tttgatgaaataattgtgaaaattaagggtactggagatgtgagtgaaaagcttgctaat
aatgttgagacacttcaaggtgaggctgatgcaataaaaggtattgctacagtagtaacg
gagataagtgaacaaacaaatcttttggctttaaatgcatctattgaagcggcaagagca
ggtgagcatggaaaaggatttgctgtagtagcagatgaagttaaagaattagcagaacaa
tcctcaagttctgcagaggaaataacaaaaattattgataatataactttaaaaatagct
caaataactaaagaagctaatgagcaagcggaaagtacaaaggatgatataaaatttgca
gatggatctaaaaattcattttcaaaaattaaagagtcaactagttcaacttatgatgcc
attaatgaaatacataaattagctagccaaacgtcattaatgtctgataaggtaaatgaa
ttaataaatggtatcattttagctaatgaagaatcagtagcctttacacaggaagtttct
gcatcagcacaggaacaatcagcatcaatggaaagtctttctgaattaataaaaaatatg
aatgatgcagcagatagtgtagatttaaagcttaaagattttataaacaatatagaaata
ggagagaatgaaaaaaattctattaagtctggattcttaaatctgaaaaatataaatgaa
gaaataaactctaaagctttgccaatggatggagtttcacagttattaaaggaaaaagaa
aatttatataaagaatttgaatatataggtgtgatggataagaaaggtattatgaaatct
gctagtaagcctatatcatctgaaaataataactattcatttaggccttattttaaagag
gcaatgaaaggaaatgaatattatactgaaccatatatatccaatgtatcttttaattac
tgtattgccatagcagtaccatttaaaaataagtttggagaaattgatggagttattatg
gcagatttgattatagaaaaataa

KEGG   Clostridium carboxidivorans: Ccar_24005
Entry
Ccar_24005        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_24005
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_24005
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_24005
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_24005
SSDB
Motif
Pfam: MCPsignal dCache_1 HAMP Peptidase_S49 DUF3215
Other DBs
NCBI-ProteinID: AKN33722
LinkDB
Position
5343696..5345762
AA seq 688 aa
MNKKAIGIKGRILLSSMVVLLITLVSISSILIYEINKKSHEDYFANSKEQMKIVSQAINI
FYDQIDKNIDMLTTNPSVMMADNSITTYKNTTQDTPMKPSAKAGIEQEIYKVFEQYANSH
KGTSYVYLGTEDGGYIQWPEESLPAGFDPSKRPWFNDAMNKKGSVIRTAPYSYKSQLLTS
NARTITDKNGKIIGAIGIDVQQTNISDMLNKMKIGKTGYSMIVHSNGLIMADGKNPKNNF
KKVGEVGINGLDKLLAKDLKSFDVVVDGEKYIVNPYKVEGTDWILASFMTEKELGAGAKE
IVNIMIFSAGAMLILATILFNFLSSSITKPILAVTKRVQDFANLDFSVDEKADTLKYLNR
KDEAGDMIRAFVSMRENVSEFIVKTAHSTEKVAASSEELTATSEQAATASNEVSKAIEEI
AKGATDQAKDTQMAAHNVEDLGNLLEQDLNYIEELNVAAVEIERQKSEGFLILKELVEKT
KKNNDSANNVYHIIMSNNESAEKIENASTMIQSIADQTNLLALNAAIEAARAGDAGKGFA
VVADEIRKLAEQSNNFTNDIKTVITGLKIKSQNAVDLMQQTKQIIEEQASSVGETEGKFE
GIAEAIDSIKSVVNKLNNSANLMTENKNKIIELTQNLSAISEENAAGTEQASSSMQEQVN
TIEQIAIAGESLATISEELRVLVDKFKV
NT seq 2067 nt   +upstreamnt  +downstreamnt
atgaataaaaaggctattggaataaagggaaggattttactatcttcaatggtagttctt
ttgataaccttagtaagtattagtagtattctaatttatgaaattaataaaaagtctcat
gaagattattttgctaattctaaagaacaaatgaagatcgtttctcaagcaattaacatt
ttttatgatcaaattgacaaaaatattgatatgctaacaacaaatccatcagtaatgatg
gctgataacagtattacaacctataaaaatacaactcaagatactccaatgaaaccttca
gctaaagcaggaattgaacaggaaatttataaagtgttcgagcaatatgcaaacagccat
aaaggtacaagctatgtgtatttaggaacagaagatgggggatatatacaatggccggaa
gagagtctaccagcaggatttgatccttcaaaaagaccttggtttaatgatgcaatgaat
aaaaagggaagtgttattagaacagctccatacagttataagtcccaactgcttacaagt
aatgctcgtacaattactgataaaaatgggaaaattataggtgccataggaatagacgta
cagcaaactaatattagcgatatgttaaataaaatgaaaattggtaaaacaggatattca
atgattgtacatagtaatggtcttataatggcagatggaaaaaatcctaaaaacaatttt
aaaaaggttggagaagttggtattaacggattagataagcttctagctaaagatctaaaa
tcatttgatgttgttgttgatggcgaaaagtatattgttaatccttataaagtagaagga
actgattggatactagcatcatttatgacagaaaaagagttaggagctggtgcaaaagaa
atagtaaatataatgatattttctgcaggggccatgttaatattggcaactattttattt
aattttctttccagtagtataacaaaacctatcttagcagtaacaaagagagtacaagat
tttgctaatttggatttttcagtagatgaaaaggcagacacactaaaatacttaaacagg
aaagatgaagcaggagatatgataagagcctttgtaagtatgagagagaatgtatcagaa
ttcattgtgaaaactgcacattcaacagaaaaggttgcagcttcatcggaagaattaact
gctacttcggagcaagcagctactgcatcaaatgaagtaagtaaggctattgaggaaatc
gcaaaaggagctactgatcaagctaaagatactcagatggcagcccataatgtagaagat
ttaggtaatttattagaacaagatttaaattatattgaagaattgaatgttgcggcagtt
gaaattgaaaggcaaaaatcagaaggttttttaattttgaaagaacttgttgaaaaaact
aagaaaaataatgattctgcaaacaatgtttaccatattatcatgagtaacaatgaaagt
gcagaaaaaattgaaaatgctagtactatgattcaaagtattgcagaccagacaaatctt
ttagctttaaatgctgcaatagaagcagcaagagctggagacgcaggtaaaggctttgca
gttgttgctgatgaaataagaaagcttgcagaacaatcaaataactttacaaatgacatt
aaaacagtaataactgggttaaagataaaatcacaaaatgcagttgatttgatgcagcaa
actaagcagataattgaggaacaagcttctagtgttggagaaactgaaggaaaatttgaa
gggatagcagaagcaatagattctataaaatctgtagttaataaacttaataattctgcc
aatttaatgacagaaaataaaaacaaaatcattgaattaactcaaaatttatctgcaatc
tctgaagagaatgctgctggaacagaacaagcatcatcatctatgcaagaacaagtcaat
acaattgaacaaattgccatagcaggagagagcttagctacaatctcagaagaattaaga
gtgttagtagacaaatttaaagtctag

DBGET integrated database retrieval system