KEGG   Clostridium carboxidivorans: Ccar_00995
Entry
Ccar_00995        CDS       T03979                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
cck  Clostridium carboxidivorans
Pathway
cck00220  Arginine biosynthesis
cck00250  Alanine, aspartate and glutamate metabolism
cck00270  Cysteine and methionine metabolism
cck00330  Arginine and proline metabolism
cck00350  Tyrosine metabolism
cck00360  Phenylalanine metabolism
cck00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cck00401  Novobiocin biosynthesis
cck01100  Metabolic pathways
cck01110  Biosynthesis of secondary metabolites
cck01210  2-Oxocarboxylic acid metabolism
cck01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cck00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ccar_00995
   00270 Cysteine and methionine metabolism
    Ccar_00995
   00220 Arginine biosynthesis
    Ccar_00995
   00330 Arginine and proline metabolism
    Ccar_00995
   00350 Tyrosine metabolism
    Ccar_00995
   00360 Phenylalanine metabolism
    Ccar_00995
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ccar_00995
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Ccar_00995
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cck01007]
    Ccar_00995
Enzymes [BR:cck01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     Ccar_00995
Amino acid related enzymes [BR:cck01007]
 Aminotransferase (transaminase)
  Class I
   Ccar_00995
SSDB
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Aminotran_MocR Cys_Met_Meta_PP Alliinase_C Aminotran_3 Amidohydro_1
Other DBs
NCBI-ProteinID: AKN29491
UniProt: C6PQV0
LinkDB
Position
194232..195425
AA seq 397 aa
MILSKKAQQIQPSITLAITAKAKKMKSEGIDVIGFGAGEPDFNTPENIQNAAIQAIKQGF
TKYTAASGITELKEAIANKFYKDNGLKYNASQIIISTGAKQCLANAFSATLNPGDEVIIP
IPYWVSYPELVKLADGVPVFVETSEANNFKYDIKDLEKAITDKTKIILVNSPNNPTGTVY
TKEELIAIAQLAKKHDLIILSDEIYEKLIYGDEKHISIGSLSEDAYNRTITINGVSKTYS
MTGWRIGYAAANEEIIKLMSSLQSHTTANPNSIAQYASVEALNSDEVQIEKMVKEFKSRR
DYMVKKINEIENLSCTEPKGAFYVMMNISKTFGKKSNGCEVKDSLTFSQALLEKEKVAVI
PGIGFGMDNYVRLSYATSMDNIKAGLDRIEKFVAELQ
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgatactatcaaaaaaagctcagcaaattcaaccatctattacattagctataacagca
aaggctaaaaaaatgaagtcagaaggaattgatgtaattggatttggagctggagaacca
gactttaataccccagaaaacatacaaaatgcagctatccaagctataaagcagggattt
acaaagtatacagctgcatctggaattacagaattaaaggaagctatagctaataagttt
tataaggataatggcctaaaatacaatgcttcacagattataatttctacaggggcaaag
cagtgcttagcaaatgccttttcagcaacattaaatcctggagatgaggttataatacca
ataccatattgggtaagttatcctgaactggtaaaattagcagatggtgtacctgtattt
gtagaaactagcgaagctaataattttaaatatgatataaaggatttagaaaaagcaata
acagataaaacaaaaattatacttgtaaatagtcctaataatcctacaggaactgtttat
acaaaagaagagttaatagccatagcgcagttagctaagaagcatgatttaataatacta
tctgacgaaatatatgaaaaacttatatatggagatgaaaaacatataagcattggcagt
ctttcagaggatgcttacaataggactataactataaatggagtttctaaaacttattct
atgacaggttggagaattggatatgctgcagctaatgaagaaataataaaattgatgtca
agtctccaaagtcatactacagctaatcctaattcaattgcgcagtatgcatctgtagaa
gctttaaatagtgatgaagtacaaattgaaaaaatggtaaaagaatttaagagcagaaga
gattatatggtaaaaaagataaatgaaatagaaaatttatcttgcactgaacctaaaggt
gctttttatgtaatgatgaatatatcaaagacatttggtaaaaagtctaatggatgtgaa
gttaaggattcattaactttttcacaagcacttttagaaaaagaaaaggttgcagttata
ccaggtataggatttggcatggataactatgtaagattgtcttatgctacatctatggat
aacataaaagcaggattagatagaatagaaaaattcgtagctgaattgcaataa

KEGG   Clostridium carboxidivorans: Ccar_04055
Entry
Ccar_04055        CDS       T03979                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
cck  Clostridium carboxidivorans
Pathway
cck00220  Arginine biosynthesis
cck00250  Alanine, aspartate and glutamate metabolism
cck00270  Cysteine and methionine metabolism
cck00330  Arginine and proline metabolism
cck00350  Tyrosine metabolism
cck00360  Phenylalanine metabolism
cck00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cck00401  Novobiocin biosynthesis
cck01100  Metabolic pathways
cck01110  Biosynthesis of secondary metabolites
cck01210  2-Oxocarboxylic acid metabolism
cck01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cck00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ccar_04055
   00270 Cysteine and methionine metabolism
    Ccar_04055
   00220 Arginine biosynthesis
    Ccar_04055
   00330 Arginine and proline metabolism
    Ccar_04055
   00350 Tyrosine metabolism
    Ccar_04055
   00360 Phenylalanine metabolism
    Ccar_04055
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ccar_04055
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Ccar_04055
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cck01007]
    Ccar_04055
Enzymes [BR:cck01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     Ccar_04055
Amino acid related enzymes [BR:cck01007]
 Aminotransferase (transaminase)
  Class I
   Ccar_04055
SSDB
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_5 DUF4116 Intein_splicing Beta_elim_lyase
Other DBs
NCBI-ProteinID: AKN30042
UniProt: C6PRU7
LinkDB
Position
complement(939381..940580)
AA seq 399 aa
MKFSDRITAMECSPIRKLIPYANKAKEKGKKVYHLNIGQPDIATPRQFFDAVKNFNCEIL
TYSPSNGIPELIDAVIPYYRNYGMEFSKDDILVTNGGSEALLFTLMSLFDKGDDIVIPEP
FYANYKSMFQVLEINVVPISTKVEEGFHLPSKAEIEKIITPKTKAILISNPGNPTGTAYT
REEINTLASVAKEKGIFIISDEVYREFVYDNLDYASFGTIKDIEDNVIIIDSISKRYSAC
GARVGLIVSRNKEFMTNAFKLCEVRLSVAELEQIGAAALYKTPQNYLKEVNEEYKKRRDI
VFEALSSMEGVVCRKPEGAFYYMVKLPVDNAEKFVIWLLEEFDVDGETLMMAPADGFYET
EGRGIDEVRIAYILNESDLLKSMNILKEGLKKYPGRTTK
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgaaattttctgacagaataactgcaatggagtgctctccaataagaaaactaatacca
tatgctaataaagctaaagaaaaaggtaaaaaggtttaccatttaaatattggacaacct
gatatagcaacaccaagacaattttttgatgctgtaaaaaactttaattgtgaaatttta
acttactcaccatctaacggaatacctgaattaattgatgctgtaattccttactataga
aattatggtatggaattttcaaaggatgatatattagtaactaatggtggaagtgaagct
ttattattcacacttatgtcattatttgataaaggtgatgacatagttattcctgaacca
ttttatgcaaattacaagagcatgtttcaagtgctagaaataaatgttgttcctataagc
actaaggttgaggaaggtttccatcttccttcaaaggctgaaattgaaaaaattattact
cctaaaacaaaagctatactaatatcaaatcctggaaacccaacaggaacagcttacaca
agagaagaaatcaatacattagcttctgttgctaaagaaaaaggtatatttataatatct
gacgaagtttacagagagtttgtatatgataatttggattatgcaagctttggaactata
aaggatatagaagataatgttataataatagacagcatatctaaaagatatagtgcttgt
ggtgctagagtaggtttgatcgtaagcagaaacaaagagtttatgacaaatgcctttaaa
ctttgtgaagtaagattatctgttgctgaattagaacagataggagcagcagctttatac
aaaactccacaaaattatctaaaagaagttaatgaagaatataaaaagagaagagacata
gtttttgaagcccttagcagcatggaaggtgtagtatgcagaaaaccagaaggagctttc
tattacatggtaaaacttccagtagataatgcagaaaaatttgtaatttggcttttagag
gaatttgatgttgatggagaaacattgatgatggcaccagcagatggcttctatgaaaca
gaaggacgtggaatagatgaagttagaatagcttatattcttaatgagtctgatttgtta
aaatccatgaatattttaaaagaaggattaaaaaaatatccaggaagaactacaaagtag

KEGG   Clostridium carboxidivorans: Ccar_04435
Entry
Ccar_04435        CDS       T03979                                 

Definition
(GenBank) aminotransferase class I/II
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
cck  Clostridium carboxidivorans
Pathway
cck00220  Arginine biosynthesis
cck00250  Alanine, aspartate and glutamate metabolism
cck00270  Cysteine and methionine metabolism
cck00330  Arginine and proline metabolism
cck00350  Tyrosine metabolism
cck00360  Phenylalanine metabolism
cck00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cck00401  Novobiocin biosynthesis
cck01100  Metabolic pathways
cck01110  Biosynthesis of secondary metabolites
cck01210  2-Oxocarboxylic acid metabolism
cck01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cck00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ccar_04435
   00270 Cysteine and methionine metabolism
    Ccar_04435
   00220 Arginine biosynthesis
    Ccar_04435
   00330 Arginine and proline metabolism
    Ccar_04435
   00350 Tyrosine metabolism
    Ccar_04435
   00360 Phenylalanine metabolism
    Ccar_04435
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ccar_04435
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Ccar_04435
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cck01007]
    Ccar_04435
Enzymes [BR:cck01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     Ccar_04435
Amino acid related enzymes [BR:cck01007]
 Aminotransferase (transaminase)
  Class I
   Ccar_04435
SSDB
Motif
Pfam: Aminotran_1_2 Aminotran_MocR
Other DBs
NCBI-ProteinID: AKN30109
UniProt: C6PWY4
LinkDB
Position
1032823..1034139
AA seq 438 aa
MNKPVLSAHFESRTPSDVRLAQMKYDEREVKPEAVINVGIGNVSLPTNPAMQKRMFALNA
PESPFAKGVVRYSGTAGFEECQNAFKNILSCEGFDTSKLLVQVTDGGSSGMELVLLGVCG
PAGTDEKPFMMIDPAYTNYISFAERIGRKTVTVKRSLGEDGKFSLPKLDEIEQTIKKNNP
GALLVIPYDNPTGQLYDYETLKGLAALCVKYNMWMVSDEAYRELYYTGDNSLVSIWGITD
ADVPGIEGRRISLETTSKVWNACGLRIGAVITDNPEYNNRSIAEYTANLCANVIGQYIFG
ALAHESKESIIGWCKSLREYYKDIIFKVYNGLKEQEPGLIVSSPDASIYSVIDVRNVVKP
GFDAIDFVLYCAQKGAVDCNGVQTTLLVAPLKGFYDIPAGENNPGSTQFRISFVGTPEDM
MKVPELFVKLLRQYEASR
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgaataaaccagttttatcagcacattttgaatcaagaacaccatcagatgtcagattg
gcacaaatgaagtatgatgagcgtgaggttaaacctgaagctgtaataaatgtaggtatt
ggaaatgtttcacttccaacaaatcctgctatgcagaaaagaatgtttgcacttaatgct
cctgaaagcccatttgcaaagggtgttgtaagatattcaggaactgctggttttgaagaa
tgccagaatgcatttaaaaatattctttcatgtgaaggctttgatactagtaaattatta
gttcaagtaacagacggcggatcaagtggtatggaattagtattacttggtgtttgcgga
cctgcaggtactgatgaaaagccttttatgatgatagacccagcatacacaaactatatt
tcttttgcagaaagaataggacgtaaaactgttacagtaaaacgtagtttaggtgaagat
ggcaagtttagtcttccaaagcttgatgaaattgagcaaactattaaaaagaataatcct
ggagcacttcttgttataccttatgataatcctacaggacagctttatgactatgaaaca
cttaaaggacttgctgcattatgcgtaaaatacaatatgtggatggttagtgatgaagct
tatcgtgaactatactatacaggtgacaacagcctagtaagtatctggggaattactgat
gcagatgtacctggtatagagggaagaagaataagtttagagacaacatcaaaggtatgg
aatgcctgcggtttaagaatcggtgctgtaattactgataatccagaatacaataatcgt
tcaatagccgaatatactgcaaacctttgtgctaacgtaatcggtcagtacatatttgga
gcattggcacatgaaagcaaggaaagtattattggatggtgcaagagtcttcgtgaatac
tataaagacattatattcaaagtatataatggtttgaaagagcaagaaccaggcttaatc
gtttccagtcctgatgcatctatatactcagtaattgacgttagaaacgttgtaaaacca
ggatttgatgcaattgactttgttctttactgtgcacaaaaaggagctgtagattgcaat
ggagttcaaacaactcttctagtagcacctttaaaaggattctatgatattccagcagga
gagaataatccaggaagcactcagttccgtatttcattcgtaggaactcctgaagacatg
atgaaggttcctgagttatttgttaaacttttaagacagtacgaagcaagccgttaa

KEGG   Clostridium carboxidivorans: Ccar_15045
Entry
Ccar_15045        CDS       T03979                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K11358  aspartate aminotransferase [EC:2.6.1.1]
Organism
cck  Clostridium carboxidivorans
Pathway
cck00220  Arginine biosynthesis
cck00250  Alanine, aspartate and glutamate metabolism
cck00270  Cysteine and methionine metabolism
cck00330  Arginine and proline metabolism
cck00350  Tyrosine metabolism
cck00360  Phenylalanine metabolism
cck00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cck00401  Novobiocin biosynthesis
cck01100  Metabolic pathways
cck01110  Biosynthesis of secondary metabolites
cck01210  2-Oxocarboxylic acid metabolism
cck01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cck00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ccar_15045
   00270 Cysteine and methionine metabolism
    Ccar_15045
   00220 Arginine biosynthesis
    Ccar_15045
   00330 Arginine and proline metabolism
    Ccar_15045
   00350 Tyrosine metabolism
    Ccar_15045
   00360 Phenylalanine metabolism
    Ccar_15045
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ccar_15045
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Ccar_15045
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cck01007]
    Ccar_15045
Enzymes [BR:cck01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     Ccar_15045
Amino acid related enzymes [BR:cck01007]
 Aminotransferase (transaminase)
  Class I
   Ccar_15045
SSDB
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Peripla_BP_4
Other DBs
NCBI-ProteinID: AKN32108
UniProt: C6PX82
LinkDB
Position
complement(3431189..3432376)
AA seq 395 aa
MVSKEMYELGSKRSVIRELFEYGKQQAAIVGKENVFDFSIGNPTVPAPECVKEAIIELLE
TKKSDEVHGYTSAQGDFEVRKGIADYMNNTYNSQLKADNFYMTCGAAASLCIALKALTVN
SEDEFIIVAPYFPEYLVFVKSAGAKAVVVPADTENFQIQMDLLEKSINSHTKGIIINSPN
NPSGVVYSEKTFKYLADLLKRKSEEYQNTLYLISDEPYREIVYDDIQIPYVPAYYENTIV
CYSYSKSISLPGERIGYILVPDCVENTKDVYTAVCGAGRSLGYVCAPSLFQKVVLKCLGK
TSDIALYDTNRKLLYNELTKMGYQCVKPDGAFYLFVKALEEDDVNFSQNAKKFNLLIVPG
GDFGCPGYVRVSYCVDTEMLKRSFDAFEKLRDLYK
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggtatcaaaagagatgtatgaattaggatcaaaacgttctgtaattagggaattattt
gagtatggaaaacagcaggctgcaattgttggaaaagaaaatgtatttgattttagtatt
ggaaatccaactgttccagcgccagaatgtgtaaaagaagctattatagaattactggaa
acaaaaaagtcagatgaagtccatggctatacttctgcacagggagattttgaagtaaga
aaaggtatagctgattatatgaacaatacatataattcacagcttaaagcggataatttt
tatatgacatgtggtgcagcagcttcattatgtattgcacttaaggctcttactgtaaat
tcagaagatgagtttattattgttgcaccttatttcccagaatatttggtttttgtaaaa
agcgcaggtgcaaaggctgtagtagtaccagcagatacagaaaattttcaaattcagatg
gatttattagagaagtccattaattctcatacaaaaggaattataataaattctcctaat
aatccatcaggtgttgtatattcagaaaaaaccttcaagtatttagcagatttgttaaaa
aggaaatctgaagaatatcaaaatactttatatctaatatcagatgaaccttatagagag
attgtttatgatgatatacagataccatatgttccagcttattatgagaatacaatcgta
tgttattcatatagtaagtcaatttcacttccaggagaaagaataggatatatactagtt
cctgattgtgtggaaaatactaaggatgtttatacagcagtatgtggagcaggacgttca
cttggatatgtatgtgcaccaagtttattccaaaaggtagtattgaagtgtttaggcaaa
acatcagatatagcactatatgatacaaatagaaaattgttgtacaatgaacttactaaa
atgggttatcaatgtgtaaagccagatggtgctttttacttatttgtaaaggctttagag
gaagatgatgtgaatttttctcaaaatgcaaagaaatttaatcttctaattgttccagga
ggcgattttggatgtccgggatatgtgagagtttcttattgtgttgatacagaaatgtta
aaaaggtcttttgatgcatttgagaaattaagagatttgtataaataa

KEGG   Clostridium carboxidivorans: Ccar_16090
Entry
Ccar_16090        CDS       T03979                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K11358  aspartate aminotransferase [EC:2.6.1.1]
Organism
cck  Clostridium carboxidivorans
Pathway
cck00220  Arginine biosynthesis
cck00250  Alanine, aspartate and glutamate metabolism
cck00270  Cysteine and methionine metabolism
cck00330  Arginine and proline metabolism
cck00350  Tyrosine metabolism
cck00360  Phenylalanine metabolism
cck00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cck00401  Novobiocin biosynthesis
cck01100  Metabolic pathways
cck01110  Biosynthesis of secondary metabolites
cck01210  2-Oxocarboxylic acid metabolism
cck01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cck00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ccar_16090
   00270 Cysteine and methionine metabolism
    Ccar_16090
   00220 Arginine biosynthesis
    Ccar_16090
   00330 Arginine and proline metabolism
    Ccar_16090
   00350 Tyrosine metabolism
    Ccar_16090
   00360 Phenylalanine metabolism
    Ccar_16090
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ccar_16090
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Ccar_16090
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cck01007]
    Ccar_16090
Enzymes [BR:cck01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     Ccar_16090
Amino acid related enzymes [BR:cck01007]
 Aminotransferase (transaminase)
  Class I
   Ccar_16090
SSDB
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Peripla_BP_4
Other DBs
NCBI-ProteinID: AKN32301
UniProt: C6Q2F5
LinkDB
Position
complement(3661840..3663024)
AA seq 394 aa
MLSKEMYELGAKRSAIRDLFEYGKQQAAIVGKENVFDFSIGNPTVPAPGCVKEAMLELLE
TQKSEEIHGYTSAQGDFEVRKGIADYMNSTYNCQLKADNFYMTCGAAASLSIILKALTES
PEDEIVIIAPHFPEYQVFIKSAGAKIVVVPADTENFQIKMDLLEKAITSNTKGIIINSPN
NPSGVVYSEKTLKDLADLLKKKSKEYQKPLYLISDEPYREIVYDDVKILYVPDYYENTIV
CYSYSKSLSLPGDRIGYILVPDCVENGKDIYTAVCGAGRALGYVCAPSFFQKVIMKCQGK
TSDIALYDVNRKLLYNELTKMGYQCVRPDGAFYLFVKSLEENAVSFSENAKKFNLLIVPS
DDFGCSGYVRISYCVDPEMIKRSFGAFQKLRDLY
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgctatcaaaagaaatgtatgagttaggagcaaaacgctctgcaatcagagatttattt
gagtatggaaagcagcaggctgcaattgttggaaaagaaaatgtatttgattttagtatt
ggaaatccaactgttccagcaccagggtgtgtaaaagaagcaatgttagaattgttggaa
acacaaaaatcagaagaaatccatgggtatacttctgcacagggagattttgaagtgaga
aaaggtattgctgattatatgaatagtacatataattgtcagcttaaagcagataatttt
tatatgacatgtggtgcagcagcttctttaagtatcatacttaaggctcttactgaaagt
ccggaagatgaaattgtaattattgcaccacattttccagagtatcaagtttttataaaa
agtgcaggtgcaaagattgtagtagtgccagcagatacagagaattttcaaattaagatg
gatttactggaaaaagctattacttctaacactaaaggaataataataaattctcctaat
aatccatctggtgttgtttattcagaaaaaacattgaaagatttagcagatttattgaaa
aagaaatctaaagaatatcaaaaacctttgtatctcatatccgatgagccatacagagaa
atagtttatgatgacgtaaagatactatacgttccagattattatgagaatacaattgta
tgttactcatacagtaaatcactttcacttccaggagatcgaataggatatattctggtt
cctgattgtgtggaaaatggtaaggatatatatacagcagtatgtggtgctggacgtgct
cttggatatgtttgtgcaccaagtttcttccagaaagtaattatgaagtgtcagggaaaa
acatcagatatagcactatatgatgtaaatagaaaattactatataatgaacttactaaa
atgggttatcaatgtgtcagaccagatggtgcattttatttgtttgtaaaatcactagaa
gaaaatgctgtaagtttttctgaaaatgccaaaaaatttaatcttctcattgtaccatca
gatgattttggatgttcaggatatgttagaatatcttattgtgttgatccagagatgata
aaaaggtcttttggtgccttccagaaattaagagatttatattaa

DBGET integrated database retrieval system