KEGG   Clostridium carboxidivorans: Ccar_01465
Entry
Ccar_01465        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein CheW
  KO
K03408  purine-binding chemotaxis protein CheW
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_01465
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_01465
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_01465
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ccar_01465
SSDB
Motif
Pfam: CheW
Other DBs
NCBI-ProteinID: AKN29583
LinkDB
Position
302032..302526
AA seq 164 aa
MTDLIEERLEIEEDTQKGRFLMFLLDKESYGIEIKYVTEIIGIQPITEIPQLPQYVKGII
NLRGKIIPIMDVRIRFKKEPREYNDRTCVIIININNISIGLIVDSVSEVIAIFDENIVKP
PQINNGFNSRYIKGIGKVGNDVKLLLDCEKLFTEDELQDLGKSL
NT seq 495 nt   +upstreamnt  +downstreamnt
atgacagatctaattgaagaaagattagaaattgaggaagatactcaaaaaggtagattt
ttaatgtttttgcttgataaggaatcttatggaatagaaatcaagtatgttacagaaatt
ataggaattcaaccaataacggagattcctcaactgcctcaatatgttaaaggcataatc
aatctacggggtaagataattcctatcatggatgtaagaattcgctttaaaaaagaaccg
agagagtataacgatagaacctgtgtaattatcataaatattaataacatatctatagga
cttatagtagacagtgtgtcggaggtaattgcaatttttgatgaaaatattgttaagccg
ccacaaataaacaatggttttaatagtagatacataaagggaattggtaaagttggaaat
gatgtaaaactactgcttgattgtgaaaagctatttacagaagatgaacttcaagattta
ggaaaatcattataa

DBGET integrated database retrieval system