KEGG   Clostridium carboxidivorans: Ccar_01465
Entry
Ccar_01465        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein CheW
  KO
K03408  purine-binding chemotaxis protein CheW
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_01465
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_01465
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_01465
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ccar_01465
SSDB
Motif
Pfam: CheW
Other DBs
NCBI-ProteinID: AKN29583
LinkDB
Position
302032..302526
AA seq 164 aa
MTDLIEERLEIEEDTQKGRFLMFLLDKESYGIEIKYVTEIIGIQPITEIPQLPQYVKGII
NLRGKIIPIMDVRIRFKKEPREYNDRTCVIIININNISIGLIVDSVSEVIAIFDENIVKP
PQINNGFNSRYIKGIGKVGNDVKLLLDCEKLFTEDELQDLGKSL
NT seq 495 nt   +upstreamnt  +downstreamnt
atgacagatctaattgaagaaagattagaaattgaggaagatactcaaaaaggtagattt
ttaatgtttttgcttgataaggaatcttatggaatagaaatcaagtatgttacagaaatt
ataggaattcaaccaataacggagattcctcaactgcctcaatatgttaaaggcataatc
aatctacggggtaagataattcctatcatggatgtaagaattcgctttaaaaaagaaccg
agagagtataacgatagaacctgtgtaattatcataaatattaataacatatctatagga
cttatagtagacagtgtgtcggaggtaattgcaatttttgatgaaaatattgttaagccg
ccacaaataaacaatggttttaatagtagatacataaagggaattggtaaagttggaaat
gatgtaaaactactgcttgattgtgaaaagctatttacagaagatgaacttcaagattta
ggaaaatcattataa

KEGG   Clostridium carboxidivorans: Ccar_13745
Entry
Ccar_13745        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein CheW
  KO
K03408  purine-binding chemotaxis protein CheW
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_13745
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_13745
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_13745
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ccar_13745
SSDB
Motif
Pfam: CheW
Other DBs
NCBI-ProteinID: AKN31868
UniProt: C6PXU3
LinkDB
Position
complement(3145303..3145797)
AA seq 164 aa
MSEIMNGITELSEDTQKGRFLTFSVGKESYGIEIKYVKEIIGIQEITEVPELPDYVKGII
NLRGKIIPVMDVRLRFKKEAKEYNDRTCIIVIDVEEISIGLIVDNVSEVLTIGEENIVPP
PDLKTGFHNRYVKGIGKVGNEVKLLLDCEKVLNDDEIDAIKEVL
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcagaaatcatgaatggaataacagaattatcagaagatactcaaaaaggaaggttt
ttaacattttcagttggaaaggaaagctatggtatagaaattaagtatgttaaagaaata
attggaatacaggaaataacagaagtgccagaacttcccgactatgtaaaaggtataata
aatcttaggggtaagattatacctgtaatggatgtaaggttaaggtttaaaaaagaagca
aaagagtataatgacaggacatgtataatagtaattgatgttgaagaaatttccatagga
ttaatagtggataatgtttcagaagtacttacaataggagaagaaaatattgttccacca
ccagatttaaaaacaggatttcataatcgttatgtaaaaggaataggtaaagtaggtaat
gaagttaaacttttgttggattgtgaaaaagttttaaatgatgatgaaatagatgctatt
aaagaagtgttataa

KEGG   Clostridium carboxidivorans: Ccar_24945
Entry
Ccar_24945        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein CheW
  KO
K03408  purine-binding chemotaxis protein CheW
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_24945
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_24945
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_24945
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ccar_24945
SSDB
Motif
Pfam: CheW IFT81_CH DUF3236
Other DBs
NCBI-ProteinID: AKN33899
UniProt: C6PPK9
LinkDB
Position
5552951..5553397
AA seq 148 aa
MDSREAKILIFNINGEDYATDIMEVERILGYEQPTKLPDSPAFVEGVINYQGDVLPVISL
AKRFNLTKEEKKNDAKIIVSKQEDNKFGVIVDVVSEVRNINENEIETPPEIAVGISKRYI
KGLVKIQGRIIIFLNLASILTEDEKKLI
NT seq 447 nt   +upstreamnt  +downstreamnt
atggacagcagagaagctaaaatattaatatttaacataaatggagaagactatgctaca
gatattatggaagttgaaagaattttgggatatgagcagccaaccaaacttcctgattct
ccagcctttgtagaaggagtaataaattatcaaggcgatgtgttgccggtaatttcctta
gctaaaaggtttaatttgacaaaagaagaaaagaaaaatgatgctaaaataatagtatca
aaacaagaagataataaatttggagtgatagttgatgtagtatcagaagtgagaaacata
aatgaaaatgaaatagaaactccacctgaaatagcagtaggaatttcaaagagatatata
aaaggcttggtgaaaatacaaggaagaataattatatttctaaaccttgcaagcatactg
acagaagatgaaaaaaagcttatttaa

KEGG   Clostridium carboxidivorans: Ccar_24980
Entry
Ccar_24980        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein CheW
  KO
K03408  purine-binding chemotaxis protein CheW
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_24980
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_24980
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_24980
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ccar_24980
SSDB
Motif
Pfam: CheW DUF2316
Other DBs
NCBI-ProteinID: AKN34250
LinkDB
Position
5559179..5559577
AA seq 132 aa
MQVVVFKLNNEQFAVETAKVQSINDAMEITKVPKAPGHIKGLINLRGNVISLLDINLLLD
VSKSEEKQNNIIILEMEDELVGITVDQVDEVLEVEEGIIEKINDGKKAYIEGVINFKDRI
VTLIDIDKLLSN
NT seq 399 nt   +upstreamnt  +downstreamnt
atgcaggttgttgtatttaaattaaataacgaacagtttgcagtagaaactgcaaaggtt
caaagcataaatgatgctatggaaattacaaaagttccaaaggcaccaggacatataaaa
ggactcataaatttaagaggtaatgtgatatcacttttagatataaatcttttattagat
gtatcaaaatctgaagagaaacaaaataatataattatcttagaaatggaagatgaatta
gtaggaataacagttgatcaagtggatgaagttttagaagtggaagaaggaataatagaa
aaaataaacgatggtaaaaaagcttatatcgaaggagttataaattttaaagatagaatt
gtaacacttatagatatagataaacttctttcaaattag

DBGET integrated database retrieval system