KEGG   Clostridium carboxidivorans: Ccar_02060
Entry
Ccar_02060        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_02060
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_02060
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_02060
SSDB
Motif
Pfam: MCPsignal dCache_1 CK2S HAMP_2 DUF1664 ECF-ribofla_trS Retrotrans_gag DUF21 TMP_2 APG17
Other DBs
NCBI-ProteinID: AKN29694
UniProt: C6PVH7
LinkDB
Position
462438..464105
AA seq 555 aa
MKKERLLSVFMCVFIVISIIFSVIFYSFFNHLFHNGGNPEQIILYSSIIFTIFNLIIIII
LGITFFDFFMKSFAETDNLLYSISQGDLTKKVDLNRKGVVHSLYINLNNLIVKFRGLVAQ
IMTMIDKTINYTNDLNEDAENVKRYNKETTSVINHISKRMEEQMVFIKNAKDYSVDVISS
AENIADRSETISKMTHANQKTINDSYKNFEDLILKMNESAKASMETIDRIKKLGEKTSTI
QSIVDQVSEISEETNLLALNASIEAARAGESGKGFAVVAEEVKVLAESSSQQAKEIQSIV
DGIKNEIIGISSRVEYETKSINEYIEVSKIAKEYLNKMHEDTKGTFTAFAEIGAEIEEQV
NKVNKIGSIVENACETFESISASTQEVAASSQEQYSITENTVNRLGKLLDMNKQLENYIS
GFIKNYKIDEKTKKYINSGMESLKKLAKIPELQTMEYRKCTNILKEKIKNNSYFELIALM
QKDGLRKAITLDYKEDQVYVNFAHRPYFKEAILGKEFMSEPYISVDTNNYCIAMSVPIRN
EKGEILGILMADLVL
NT seq 1668 nt   +upstreamnt  +downstreamnt
gtgaaaaaggaaagattattatcggtttttatgtgtgtatttatagtaatatcaataatt
ttttctgtaattttttacagctttttcaatcatttatttcataatgggggtaatccagag
caaattatattatatagcagcataatatttactatttttaatttaattatcattattata
ttaggaataacattttttgatttttttatgaaaagttttgcagaaacagataatttgtta
tacagtatatctcaaggggatttaactaaaaaagtagatttaaatagaaaaggtgtagta
catagtttatatattaatcttaataatttaatagttaaatttagaggtttggtagctcaa
ataatgactatgattgataaaactataaattatacaaatgatttaaatgaggatgcagaa
aatgtaaagcgttataataaggaaaccaccagtgtaataaatcatatatctaaaagaatg
gaagaacaaatggtgtttataaaaaatgccaaggattattctgtggatgttataagttca
gcagaaaatatagctgatagatctgaaactattagtaaaatgacgcatgcaaatcagaaa
actataaatgatagttataaaaattttgaagatttaatacttaaaatgaatgaatctgca
aaagcaagtatggaaacaattgatagaataaaaaaactaggggaaaagacttctacaatt
caaagtattgtagatcaagtaagtgaaataagtgaggagactaatttattagctttaaat
gcgtctatagaggcggctagagcaggggaatcaggtaagggttttgctgttgtagcagaa
gaagttaaagttttggcagaaagttcttcgcagcaagcaaaagaaattcaatccattgta
gatggtataaaaaatgaaataatcggtatatcctctagagttgaatatgaaactaagtct
attaatgaatacatagaagtttcaaaaattgcaaaagaatatttaaataaaatgcatgaa
gatactaaaggtacttttactgcatttgctgaaattggagcagaaatagaagaacaagta
aataaggttaataaaataggttctatagttgaaaatgcttgtgaaacctttgaaagcata
tctgcttcaactcaggaagtggcagcatcttctcaagagcaatattccattactgaaaat
actgtgaatagacttggtaaacttttagatatgaataagcagctagaaaattatatatct
ggttttataaaaaattataaaatagatgaaaaaactaagaaatatataaatagcggcatg
gagtccttaaagaaattagctaaaatacctgaattacagactatggaatataggaaatgt
actaacattttaaaagaaaaaataaaaaataatagctattttgaattgattgcactgatg
caaaaggatggcttaagaaaagctattacattagactataaagaagatcaagtgtatgtt
aactttgctcatagaccttattttaaagaagctatattaggtaaagagtttatgtctgaa
ccatatatatctgtagatacaaataattattgcattgcaatgtcagttcctataagaaat
gaaaaaggtgaaatattaggaatacttatggcagacttggtgctttaa

DBGET integrated database retrieval system