KEGG   Clostridium carboxidivorans: Ccar_02655
Entry
Ccar_02655        CDS       T03979                                 

Definition
(GenBank) histidine kinase
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_02655
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_02655
Two-component system [BR:cck02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   Ccar_02655
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ccar_02655
SSDB
Motif
Pfam: Response_reg Glycos_transf_1 B12-binding
Other DBs
NCBI-ProteinID: AKN29805
UniProt: C6PMW8
LinkDB
Position
610810..611181
AA seq 123 aa
MGVLIVDDSMFMRHLITKILNKHEINILGEAANGREAIDKYKELKPDVVTLDLMMNEMSG
LEALEEIMKIDPEAQVIICSSMGQKAFIKEAIELGARGFVIKPFDEDSLVDEVQKALISK
KDK
NT seq 372 nt   +upstreamnt  +downstreamnt
atgggtgtactaatagtggatgactctatgttcatgagacatttaataacaaaaatactt
aataagcatgaaataaatatattaggagaagcagctaatggcagggaagctatagataaa
tataaggaattaaagcctgatgtagttactctggatttaatgatgaatgaaatgtcagga
ttagaagctttagaggagattatgaaaatagatcctgaagcacaagtaattatatgttca
tctatgggacaaaaagcttttataaaagaagcaatagaattaggtgcaagaggatttgta
ataaagccttttgatgaagattctctagtagatgaagtacaaaaagcattaatatctaaa
aaagataaataa

DBGET integrated database retrieval system