KEGG   Clostridium carboxidivorans: Ccar_02655
Entry
Ccar_02655        CDS       T03979                                 

Definition
(GenBank) histidine kinase
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_02655
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_02655
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cck02022]
    Ccar_02655
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_02655
Two-component system [BR:cck02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   Ccar_02655
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ccar_02655
SSDB
Motif
Pfam: Response_reg Glycos_transf_1 B12-binding
Other DBs
NCBI-ProteinID: AKN29805
UniProt: C6PMW8
LinkDB
Position
610810..611181
AA seq 123 aa
MGVLIVDDSMFMRHLITKILNKHEINILGEAANGREAIDKYKELKPDVVTLDLMMNEMSG
LEALEEIMKIDPEAQVIICSSMGQKAFIKEAIELGARGFVIKPFDEDSLVDEVQKALISK
KDK
NT seq 372 nt   +upstreamnt  +downstreamnt
atgggtgtactaatagtggatgactctatgttcatgagacatttaataacaaaaatactt
aataagcatgaaataaatatattaggagaagcagctaatggcagggaagctatagataaa
tataaggaattaaagcctgatgtagttactctggatttaatgatgaatgaaatgtcagga
ttagaagctttagaggagattatgaaaatagatcctgaagcacaagtaattatatgttca
tctatgggacaaaaagcttttataaaagaagcaatagaattaggtgcaagaggatttgta
ataaagccttttgatgaagattctctagtagatgaagtacaaaaagcattaatatctaaa
aaagataaataa

KEGG   Clostridium carboxidivorans: Ccar_05770
Entry
Ccar_05770        CDS       T03979                                 

Definition
(GenBank) histidine kinase
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_05770
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_05770
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cck02022]
    Ccar_05770
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_05770
Two-component system [BR:cck02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   Ccar_05770
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ccar_05770
SSDB
Motif
Pfam: Response_reg
Other DBs
NCBI-ProteinID: AKN30355
UniProt: C6PPN2
LinkDB
Position
1349792..1350154
AA seq 120 aa
MKKVLIVDNSSYMRMFVKKIIEKGGFPSTFEASGREDAIEIFKAEKPDIVLLDLNMSEFK
MDGMHVLSDIMEADSEAVVIIMSAVGHEEVKDECIAAGAKGYIKKPFTTETLLKALEEYK
NT seq 363 nt   +upstreamnt  +downstreamnt
atgaaaaaggtattaatagttgataattcgtcatatatgagaatgtttgtgaaaaaaatt
attgaaaaaggaggctttcccagcacctttgaagcatcagggagagaagatgcaatagaa
atattcaaagctgaaaaaccagatattgtactcttagatttgaatatgtcggagtttaaa
atggatggtatgcatgtattaagtgatataatggaagctgattctgaagcagttgtaatt
atcatgtcagcagtaggacacgaagaagtgaaggatgaatgtatagcagcaggagctaaa
ggttatattaagaaaccttttactactgaaactttattgaaggcattagaagaatataaa
taa

KEGG   Clostridium carboxidivorans: Ccar_08395
Entry
Ccar_08395        CDS       T03979                                 

Definition
(GenBank) histidine kinase
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_08395
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_08395
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cck02022]
    Ccar_08395
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_08395
Two-component system [BR:cck02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   Ccar_08395
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ccar_08395
SSDB
Motif
Pfam: Response_reg UPF0180 B12-binding
Other DBs
NCBI-ProteinID: AKN30857
UniProt: C6PN39
LinkDB
Position
complement(1951913..1952266)
AA seq 117 aa
MKKVLIVDDAMFMRVALKTMLEKNGYEVVGEAENGADAISKYSILKPDIVTMDITMPKMD
GVEALTEIKKQDPNCKIVMISALGQESWVKKAIIIGAKGFIVKPFKEEHVIKTLSKL
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaaaaaggttttaattgtagatgatgcaatgtttatgcgtgttgcactcaaaacaatg
cttgagaaaaatggatatgaagttgtaggagaagctgaaaatggagctgatgctataagt
aagtattcaatattgaaaccagatatagtaacaatggatattactatgcctaaaatggat
ggcgtagaagcattgactgaaataaaaaagcaggatcctaattgtaagattgttatgatt
tcggctttaggacaagaaagctgggttaaaaaagctattataattggagcaaaggggttt
atagttaaaccttttaaggaagaacatgttattaaaactttaagcaagctgtaa

KEGG   Clostridium carboxidivorans: Ccar_08400
Entry
Ccar_08400        CDS       T03979                                 

Definition
(GenBank) histidine kinase
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_08400
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_08400
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cck02022]
    Ccar_08400
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_08400
Two-component system [BR:cck02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   Ccar_08400
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ccar_08400
SSDB
Motif
Pfam: Response_reg
Other DBs
NCBI-ProteinID: AKN30858
UniProt: C6PN38
LinkDB
Position
complement(1952284..1952676)
AA seq 130 aa
MRILIAEDDLASRRFLLKFLSQYGECDIVVDGIETLDAYLIAVKENNPYDLICLDIMMPK
VDGVKVLKAIREFEDDRGIIPEKRAKIIMTTALMDTEYVHKAFELGCEAYAAKPIDTNKL
VEVMKKLELI
NT seq 393 nt   +upstreamnt  +downstreamnt
atgagaatattaattgcagaagatgatttagccagcagaagatttttattgaagtttctt
tcacagtatggggaatgtgatattgtagtagatggtatagaaactttggatgcttattta
atagctgttaaagaaaataatccttatgatcttatttgtcttgatataatgatgcctaaa
gtagatggagtaaaggtacttaaagctattagagaatttgaggatgatagagggattatt
cctgaaaaaagagcaaaaataataatgacaacagctctcatggatacagagtatgttcac
aaagctttcgaactagggtgtgaagcatatgctgctaaacctatagatacaaataagtta
gttgaagtaatgaaaaaattagaattaatataa

KEGG   Clostridium carboxidivorans: Ccar_09735
Entry
Ccar_09735        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein CheY
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_09735
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_09735
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cck02022]
    Ccar_09735
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_09735
Two-component system [BR:cck02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   Ccar_09735
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ccar_09735
SSDB
Motif
Pfam: Response_reg
Other DBs
NCBI-ProteinID: AKN31118
LinkDB
Position
2247850..2248230
AA seq 126 aa
MELHSLKVLICDDSSLIRKKLKELLFKYGCTEIFEASDGQNAIDMYKKYMPNLVFMDIVM
PVKDGITALNEIIEFDESAKVIMSSSSGTKTLLKKALEAGACEFIQKPFANIKIESILKE
FNEEVQ
NT seq 381 nt   +upstreamnt  +downstreamnt
atggaactacattcattaaaggttcttatttgtgatgattcaagtctaataagaaaaaaa
ctaaaagaactgttatttaaatatggctgcactgaaatttttgaagcctcagatggacaa
aatgccatagatatgtataaaaaatatatgcctaatttggtttttatggatatagttatg
cctgtaaaagatggcattacagccttaaatgaaattattgaatttgatgaaagtgcaaag
gttatcatgtcatcatcatcaggtactaaaacattacttaaaaaagctcttgaagcagga
gcttgtgaatttatacaaaaaccttttgcaaacataaaaattgaaagtatattaaaggag
tttaatgaggaggtgcagtaa

KEGG   Clostridium carboxidivorans: Ccar_11660
Entry
Ccar_11660        CDS       T03979                                 

Definition
(GenBank) histidine kinase
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_11660
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_11660
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cck02022]
    Ccar_11660
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_11660
Two-component system [BR:cck02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   Ccar_11660
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ccar_11660
SSDB
Motif
Pfam: Response_reg
Other DBs
NCBI-ProteinID: AKN31481
UniProt: C6PRI4
LinkDB
Position
complement(2667758..2668168)
AA seq 136 aa
MCKILIVDDECFERKVSKRIILNGMQQVDIVGEACNGKEAILMNEKLNPDIILMDIKMPI
LDGLRAAELIKNRDENKIIIFVSACEDFYFVQKAIKIGAKDYLLKSNRTEQLVETIRRHM
YPNREYFIDKAIGVYC
NT seq 411 nt   +upstreamnt  +downstreamnt
atgtgtaaaatattgattgttgatgatgaatgttttgaaagaaaagtttctaaaaggatt
atactaaatggaatgcagcaggttgatattgttggagaagcctgtaatggaaaagaagct
attctaatgaatgaaaaactaaatcctgatattattcttatggatataaaaatgccaata
ttagatggattacgtgcagcagaattaataaaaaatagagatgaaaataaaatcatcata
tttgtaagtgcttgtgaagatttttattttgtacaaaaagccataaagataggagcaaag
gattatctgttgaaatctaatagaactgagcaattagtagaaacaataagaagacatatg
tatcctaatagagaatattttattgataaagctataggagtatattgttaa

KEGG   Clostridium carboxidivorans: Ccar_24770
Entry
Ccar_24770        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein CheY
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_24770
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_24770
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cck02022]
    Ccar_24770
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_24770
Two-component system [BR:cck02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   Ccar_24770
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ccar_24770
SSDB
Motif
Pfam: Response_reg
Other DBs
NCBI-ProteinID: AKN33869
LinkDB
Position
5501491..5501874
AA seq 127 aa
MDKGQKNILVVDDSATIRSFIRLILEEANYKVYEASDGEEGIQVYKKSGNIDLIITDIYM
PKKSGLELVIELKGEYGDAKIIVLSDGGEKNFSNEMGICEKLGATYFIKKDLIKDELVKL
VTKVFSE
NT seq 384 nt   +upstreamnt  +downstreamnt
atggataaggggcaaaaaaatatattggtagttgatgattctgcaactattagaagtttt
ataaggcttattttagaagaagcgaattataaagtatatgaagcttctgatggtgaagaa
ggaattcaggtatataagaaatcaggtaatattgatttaataattactgatatatatatg
ccaaagaaaagtggccttgaacttgtaatagaattaaagggagaatatggagatgcaaaa
ataattgttctttcagatggtggagaaaagaatttttctaatgagatgggtatttgtgaa
aaacttggtgctacctattttatcaaaaaggatttaataaaggatgagctagttaaacta
gtaactaaggtgttttcagaatag

KEGG   Clostridium carboxidivorans: Ccar_24975
Entry
Ccar_24975        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein CheY
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_24975
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_24975
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cck02022]
    Ccar_24975
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_24975
Two-component system [BR:cck02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   Ccar_24975
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ccar_24975
SSDB
Motif
Pfam: Response_reg B12-binding
Other DBs
NCBI-ProteinID: AKN33905
UniProt: C6PPK3
LinkDB
Position
5558533..5558892
AA seq 119 aa
MSKVLIVDDAAFMRMMIKDILEKNGFEVIGEGNNGLKAVELYKKERPDVVTMDITMPDMD
GIEAVKAIKAFDPSAKIIMCSAMGQQTMVMDAIKAGAKDFIVKPFQPDRVLEAIKKVIG
NT seq 360 nt   +upstreamnt  +downstreamnt
atgtcaaaagtattaattgttgatgatgctgcttttatgagaatgatgataaaggacata
ttagaaaaaaatgggtttgaagtaataggagaaggaaataacggtctaaaagctgtagaa
ttgtataaaaaggaaagaccagatgtagtaactatggatataactatgccggatatggat
ggaatagaagctgtaaaagcaataaaggcattcgatccatcagctaaaataataatgtgt
tcagctatgggacagcagacaatggttatggatgcaataaaagcaggagcaaaggatttt
attgtaaaaccattccaaccagatagagtactagaagctattaaaaaagtaataggatag

DBGET integrated database retrieval system