KEGG   Clostridium carboxidivorans: Ccar_03005
Entry
Ccar_03005        CDS       T03979                                 

Definition
(GenBank) LacI family transcriptional regulator
  KO
K10439  ribose transport system substrate-binding protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02010  ABC transporters
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Ccar_03005
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_03005
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cck02000]
    Ccar_03005
Transporters [BR:cck02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    Ccar_03005
SSDB
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 Peripla_BP_3 ACP_syn_III
Other DBs
NCBI-ProteinID: AKN29863
UniProt: C6PMK8
LinkDB
Position
697827..698816
AA seq 329 aa
MKKFPIFIKYTLFILYFIIMNGILLTALREPTIIDEKIKPKITLISHVYSNPYWKYIKLG
AEKAAKQRNAVIDFQGPDTASAGEGIKFINMAYAAKVSGIITYVQDEAMYKPVIDKVLAG
GIPIVTVDSDAENSKRLAYVGTDNVTAGRVGAKEMIHHVGIYGNVGIIMGGKNVKNQIER
VNGFTEYIKSNSKLNISEIESSDSYLLEAELATKKILINNKDIKAVFCTSALDGQGAAKA
LISMGAAEKVKIICFDDLPETLDYIKNGTITSTIVQDPYGMGYKAVNIIMDIMEGKDTKG
VFLTDVIVVSKDNIDEFKKTRGEYDSEKQ
NT seq 990 nt   +upstreamnt  +downstreamnt
atgaaaaaattcccaatatttataaaatacacattatttattttatactttataataatg
aacgggatacttctaaccgctctcagagagccaactattattgatgagaaaatcaaacct
aaaataacactaattagccatgtgtactcgaatccttattggaaatatataaaattaggt
gcagaaaaggcagccaaacagagaaatgctgttattgattttcaaggaccagatactgca
agcgcaggggaaggtataaaatttataaatatggcttatgctgctaaagtcagcgggatt
attacatatgttcaggatgaagctatgtataaacctgttatcgacaaagtattagcaggt
ggaattcccattgtaacagtggattccgatgcagaaaatagtaaacgtttagcttatgta
ggtactgataatgttactgcaggcagagttggcgctaaggaaatgattcatcatgttggc
atctatggcaatgtaggaattattatgggtggaaaaaatgttaagaatcaaattgaaaga
gtaaatggtttcactgagtatataaagagtaattcaaaacttaatatatcagagattgag
tcctcagattcatatcttttggaagcagagcttgcaactaaaaaaatattgataaataac
aaggatattaaggctgtattttgtacttcagcactagatggacaaggtgcagctaaagca
ttaatcagtatgggagctgcagaaaaagtcaagattatttgttttgatgatttgcctgaa
acccttgattatataaaaaatggaaccattacttctacaattgtacaagacccctatggt
atgggatataaagcagtaaatataataatggatattatggaaggtaaagatactaaaggt
gtatttcttacagatgttattgtagttagtaaagataacattgatgaatttaaaaaaaca
cgaggagagtatgatagtgaaaagcagtag

KEGG   Clostridium carboxidivorans: Ccar_08325
Entry
Ccar_08325        CDS       T03979                                 

Definition
(GenBank) LacI family transcriptional regulator
  KO
K10439  ribose transport system substrate-binding protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02010  ABC transporters
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Ccar_08325
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_08325
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cck02000]
    Ccar_08325
Transporters [BR:cck02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    Ccar_08325
SSDB
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 Peripla_BP_6 Peripla_BP_3 CbiC
Other DBs
NCBI-ProteinID: AKN30843
UniProt: C6PN56
LinkDB
Position
complement(1933193..1934161)
AA seq 322 aa
MKKARKILGLVLSLSLVVGLFVGCGSSSSGSSQSSSTKKKHKFGYTCMTMNNPFFQVLEK
SIRAEVEKNGDQLITMDPAMDVSKQIDQINDMITQGVEAVFLNPVDWEGVRPGLEALKKA
NIPIINFDTEVKDMNYVTAYVGSDNKNAGKVCGDDLVKRYPNGGKIAILNCPTMNSINDR
IAGFKSAIEGKNFTIVAEQDGKGDLQTSMKLADDILQSHSDIVAIMGGNDPTALGALAAC
KSAKQSKILIYGVDGSPDAKKEIASGGQFVGTGAQSPKQIGVKSAELGYKVLNKQNVEKK
TPVQTFLINKDNVSKYGTTGWQ
NT seq 969 nt   +upstreamnt  +downstreamnt
atgaaaaaagcaagaaaaatactaggtctcgtattgtcactttccttagtagttggatta
tttgtaggctgtggttctagttcatcaggatcatcacaaagttcatctactaagaaaaaa
cacaaatttggttacacttgtatgacaatgaataacccattcttccaagtacttgaaaaa
tctataagagcagaagttgaaaagaatggagatcaacttattactatggatccagcaatg
gatgtttcaaaacaaatcgatcaaataaatgatatgattacacagggtgttgaagcagta
ttcttaaatcctgttgattgggaaggtgttagacctggacttgaagctttaaaaaaggct
aatattccaataatcaactttgatacagaagttaaggatatgaattatgtaactgcttac
gttggttctgataacaaaaatgcaggtaaggtatgcggagatgatttagtaaagagatat
ccaaatggtggtaaaatagctatacttaactgtcctacaatgaattctattaatgataga
atagctggtttcaagagtgctattgaaggaaagaactttacaatagttgcagaacaagat
ggaaaaggcgatttacagacatctatgaaattagctgatgacatacttcaatctcattct
gatatagttgctataatgggtggaaatgaccctacagctcttggtgctcttgcagcatgt
aaatctgctaagcaatctaaaattttaatttatggtgtagatggttcaccggatgctaaa
aaggaaattgcaagtggtggacaatttgttggaacaggtgctcaatctccaaagcagata
ggtgttaaatctgctgaacttggatataaggttcttaataaacaaaatgttgaaaagaaa
acaccagttcaaactttcttaattaacaaagataacgtttctaaatatggaacaactgga
tggcaataa

KEGG   Clostridium carboxidivorans: Ccar_20310
Entry
Ccar_20310        CDS       T03979                                 

Definition
(GenBank) D-ribose transporter subunit RbsB
  KO
K10439  ribose transport system substrate-binding protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02010  ABC transporters
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Ccar_20310
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_20310
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cck02000]
    Ccar_20310
Transporters [BR:cck02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    Ccar_20310
SSDB
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 Peripla_BP_3 Peripla_BP_6 PucR LPD22 ATPgrasp_N PTS_EIIB
Other DBs
NCBI-ProteinID: AKN33065
UniProt: C6PQA2
LinkDB
Position
complement(4541019..4541939)
AA seq 306 aa
MKRTRLKMMSLMLTGALAIAGLTGCGNSNQQQSSNQGGKKKIGMVISTLNNPFFVTMKDG
ATKKAKELGYDLVVVDSQNDATKERSNVDDLVQQGVSALIINATDSDAVGNSIKVANDKK
IPVITVDRQANSGTVVTHIASDNVKGGKMAAEFILQQLGGKANIVELQGQPGASATRDRG
KGFHEGVDGKANVKVVASQSADFDRQKGLNVMQNIMQSTPQFDAVFAHNDEMALGAVKAL
QGKKIIIVGFDGTDDAKKAVANGEMTATVAQQPDLMGSLAIENAVKVIKGESVPKQIPVD
LKLIKK
NT seq 921 nt   +upstreamnt  +downstreamnt
atgaaaagaacacgtttaaaaatgatgtcacttatgttaacaggtgcacttgcaattgca
gggcttacaggatgtggtaacagcaatcaacaacaatcatctaaccaaggtggtaaaaag
aaaataggaatggtaatatcaactttaaacaacccattctttgttacaatgaaagatgga
gcaactaaaaaggcaaaagaattaggttatgatttagtagttgttgattcacaaaatgat
gcaacaaaagaaagatcaaatgtagatgatcttgtacaacaaggtgtttcagcattaatt
ataaatgctacagacagtgatgctgttggaaattcaattaaagtagcaaatgataagaaa
ataccagttataactgtagataggcaagcaaatagtggaacagttgttactcatatagct
tcagacaatgttaagggtggaaaaatggcagcagagtttatactacaacaattgggagga
aaagcaaatatagttgaacttcaaggacaaccaggagcatcagctacaagagatagaggt
aaaggattccatgaaggtgttgatggtaaagctaatgttaaggtagttgcaagtcagtca
gcagattttgatagacaaaagggattaaatgtaatgcaaaacataatgcaatctacacca
cagtttgatgctgtttttgctcataatgatgaaatggcattaggtgcagttaaagcatta
caaggcaaaaagattataatagtaggttttgatggtactgatgatgctaaaaaggcagtt
gcaaatggtgaaatgacagctacagttgctcaacaaccagatttaatgggaagtttagct
attgagaatgctgtaaaagttataaagggtgaaagcgttccaaaacaaatacctgtagat
ttaaaacttataaaaaaataa

DBGET integrated database retrieval system