KEGG   Clostridium carboxidivorans: Ccar_04060
Entry
Ccar_04060        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_04060
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_04060
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_04060
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_04060
SSDB
Motif
Pfam: MCPsignal dCache_1 HAMP dCache_2 sCache_3_2 Phasin_2 HAMP_2 Peptidase_A8 MAD COG2
Other DBs
NCBI-ProteinID: AKN30043
UniProt: C6PRU6
LinkDB
Position
complement(941307..943388)
AA seq 693 aa
MKSIKNKLITFAVLLVLLPVLITNFVCYYYFSSSISSNVIDNNKKLSSTISDGVKDFIDK
AYTLTEEMAQNKTTIDFNQENQKEMLTNALAKNPYFDLLYIQNTSGKQTARSSGELGDRS
NRWWFTQMMKDKKPFVSKSYYSASGNMAVTSIFHPIFDKNSNMLGIFGADLKLNELQKLV
DKYSDGKNVYSFILDSEGVVIAHPDKTQVSELYNYKTLKKTVLVKDASGNVEKDASGNLK
TKLEDIAIPQTLKETVGKALKGESGVVEYSDNNKKEMLGAYTTIKLPGQSQSWAVVTVEN
KAYAMSVLKSTQLKNTFIALGLLILIAILIYLLAKKFTQPILELVDLMKRASEGDLTVKC
NHKSEDEIGNLSYNFNCMVSQIRDLINNISNTSNLVTDSAKTLAINTDATSQSIDQVTLN
ISDVAAAAEKQTSNSITGLDTTTKLSDEISIMTNYMNEGKMSAEKIYTVSTKGVNIIGSL
ETAAKENNNSINNIAVVVNSLSEKANVIGNIADTITSISEQTNLLALNAAIEAARAGDAG
KGFSVVADQVRKLSEDTASSSNNVKDIISNVQKDVNKAKEAITQAELVVKKQNDAVKYTG
ETFNEISSKIQDVVNKIITTASSLDNVLVSRDQLLILMEDAAKVSETLSASSEHVSAITE
EQNAAMEEVTALAEDLNKMSSTLNESIKIFKLN
NT seq 2082 nt   +upstreamnt  +downstreamnt
atgaaatctattaaaaacaaattaattacttttgcagtattattagtattattaccagtt
ctaattactaattttgtatgttattactatttttccagcagtatatcttctaacgtaatc
gataacaacaaaaaactttcatctacaatatctgatggtgttaaggattttatagataaa
gcctacacacttactgaagaaatggcccaaaacaaaacaactattgatttcaatcaggaa
aatcagaaagaaatgcttacaaacgctttagctaagaatccttattttgacttactttat
attcaaaatacttctgggaaacaaacagctcgttcctctggagaattaggagatagatct
aatagatggtggtttactcaaatgatgaaggataaaaaaccttttgtcagtaaatcttat
tactctgcaagtggaaatatggctgtgacttcaatatttcacccaatttttgataaaaat
tctaatatgttaggaatatttggagccgatcttaaattaaatgaattacaaaaacttgtg
gacaagtattcggatggtaaaaatgtctactcatttattttggatagtgaaggtgttgta
attgctcatcctgataaaactcaagtttcagaactttataattataaaactttgaaaaaa
acagtattagttaaagatgcctctggtaatgtagaaaaagatgcatcaggaaatctaaaa
actaagcttgaagatatagctattcctcaaacccttaaagaaaccgttggaaaagcacta
aagggagaatctggtgttgttgaatactcagataataataaaaaagaaatgttaggtgcc
tatactacaataaagcttcctggtcaatcacaaagttgggcagtagtaacagttgaaaac
aaagcctacgctatgtcagtactaaaatctactcaacttaagaatacttttatagcctta
ggattattaatactaattgccatattaatatatttgttggctaaaaaatttacacaaccc
attcttgaactagtagatttaatgaaaagggcatctgaaggagacttaacagttaaatgt
aaccataaaagtgaagacgaaattggcaacttaagctacaactttaattgtatggtatct
caaattagggatcttattaacaatataagcaatacttcaaaccttgtaacagattcagct
aaaactttagcaattaacactgatgcaacttctcaatctattgaccaagttaccttaaat
atttcagatgttgctgctgctgctgaaaaacaaacttcaaattctattactggacttgat
acaactacaaaattgtcagacgaaatttctatcatgaccaattatatgaacgaaggaaag
atgtctgctgaaaaaatatatactgtcagcactaaaggagttaatattattggcagctta
gaaactgctgcaaaagaaaataataattctataaacaatatagcagtagttgtaaattct
ctaagcgaaaaagctaatgtaataggaaatatagcagatactataacttcaatttcagaa
caaactaatcttttagctttaaatgctgctatagaagctgcaagagctggggacgctgga
aaaggattctctgtagttgctgatcaggttaggaagttatcagaagatactgcttcctca
agtaacaatgttaaagatattatatccaatgttcaaaaggatgttaataaagccaaagag
gccataactcaagcagaacttgtagtaaaaaaacaaaatgatgcagttaaatatactggt
gaaacctttaatgaaatttcctcaaaaattcaagatgtagtaaacaaaattattactact
gcatccagccttgataatgtacttgttagtagagatcaactacttatacttatggaagat
gcagcaaaagtatctgaaactctatcagcatcttctgagcatgtttcagctataacagaa
gaacaaaatgcagctatggaggaagtaacagcactggcagaagacttaaataaaatgtcc
tccactcttaatgaatcaataaaaatcttcaaattaaactaa

DBGET integrated database retrieval system