KEGG   Clostridium carboxidivorans: Ccar_04450Help
Entry
Ccar_04450        CDS       T03979                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cck  Clostridium carboxidivorans
Pathway
cck00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cck00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Ccar_04450
Enzymes [BR:cck01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Ccar_04450
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Ccar_04450
    1.1.1.-  
     Ccar_04450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ApbA PALP 2-Hacid_dh_C ADH_N_assoc ADH_zinc_N_2 NAD_binding_7 Oxidored_nitro AlaDh_PNT_C Shikimate_DH FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AKN30112
UniProt: C6Q2I5
LinkDB All DBs
Position
1037844..1038917
Genome map
AA seq 357 aa AA seqDB search
MKAALWYDKKDVRVEEIEEPKVVKGSVKIKVKWCGICGSDLHEYLGGPIFIPVGQPHPLS
GNTAPVVLGHEFSGEVVEIGEGVTNFNVGDRVVVEPIVACGKCPACREGKYNLCSSLGFH
GLCGSGGGFAEYTVFPEEFIHKIPDNMSYEQAALIEPMAVALHSIRIANFKTGDTALVLG
SGPIGLATIECLKAAGAKLVVVLQRKSVRQEYAKRAGADVVLDPNEVNIAEEVKKLTGGV
GVDVAFETTGAKIGFDTGLDSLKFEGTLVITSIWEGETSFNPNVLVFSEKKIVGTLAYRH
EFPATIAQMSDGRIKAEGYITKKILLDDIVEGGFGALTGPEKKSHVKIIITPDKSLL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcattatggtatgataagaaagatgttagagttgaagaaattgaagaacca
aaggtagtaaagggatcagtaaaaattaaggttaaatggtgtggaatttgtggttctgac
ttacatgaatatttaggaggccctatatttattccagtaggacaacctcatcctctaagt
ggtaatacagctcctgtagttttagggcatgaattctcaggcgaagttgtggaaataggt
gaaggagttacaaattttaatgttggagatagagtagttgttgaaccaattgtagcttgt
ggtaaatgtccagcatgcagagaaggaaaatataatctttgctcatctctaggtttccat
ggactttgtggaagcggtggtggatttgcagaatatactgtattcccagaagaatttatt
cataaaattccagataatatgtcttatgaacaagctgcattaatagaacctatggcagta
gcacttcattcaataagaattgctaattttaaaactggagatacagctctagtattagga
tcaggtccaataggacttgcaactatcgaatgtttaaaagcagctggtgctaaacttgta
gttgttttacagagaaaatcagtaagacaggaatatgcaaaaagagctggtgcagacgta
gttctagatccaaatgaagttaatatagctgaagaggttaaaaagcttacaggtggagtt
ggtgttgatgtggcttttgaaactacgggcgctaagataggttttgatactggacttgac
tcattgaagtttgaaggaactttggtaataacaagtatttgggaaggcgagacaagcttc
aatcctaatgttttagtattctctgaaaagaaaatagttggaacactagcttatagacat
gaattcccagcaacaattgcacaaatgagtgatggaagaataaaggcagaaggatatatt
acaaagaaaattctactagatgatatagtagaaggaggctttggtgctttaactggacca
gaaaagaaatcacatgtaaaaataattataactccagataaatcacttttatag

DBGET integrated database retrieval system