KEGG   Clostridium carboxidivorans: Ccar_04845
Entry
Ccar_04845        CDS       T03979                                 

Definition
(GenBank) hypothetical protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_04845
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_04845
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_04845
SSDB
Motif
Pfam: dCache_1 MCPsignal dCache_2 Seryl_tRNA_N
Other DBs
NCBI-ProteinID: AKN30185
UniProt: C6PUM7
LinkDB
Position
1121350..1123365
AA seq 671 aa
MKNKIKLSVKKLLMTFIPLFVIIPIFIISIFNGIKVKDNETRNFYDLMSASNGKISNIIA
DMYTNNKKTIDMFSVNDDVVGLKQKPELEASMMKTFNDYIKYHEEIRAIYYGEASKVHHT
TSGKPKPGYDPTSRPWYTKAVQEDGKVALTDPYEDVVKPGTYVVTLAKTVKDPNTKETLG
VIGGDIPLDTISKEISNIKIGNSGYTAVVDQTGTIIAHKDKKLVSKKSKDLKWLDEIIKS
KDSSNIVNIDGQKYLTLKSQNSETGWLTVTFVPNQELSDKIKSLIIPNIMVGLICAILGI
IVSLFISKYLINSIYEIIEILKNIGKGNLSVQIECRDNELKEVSMIKEEINVMKKEIVSI
TDKTIEVSEKLNESAKHFASVTQEVSSSAEEVSGSVSQITEGAANQADHLQESSTSVETL
GELVDNTLKSAKSMEETSGEANKVIENSMKLVDNLKNNLEEGFQVNEELIKEAKVLNSNS
QEIVGIINNIKDIAEQTNLLALNAGIEAARAGEYGKGFVVVAEEVRKLAEQSTIFADEIE
IVIGKMKNSVGMVTEKIKNTKETNMNTKENMVTVDNGFVKVEKNIDELKNHINIVVEALK
NINENKKVVVTKIEEVAAISEEAAAATEEVNAASEEQAANLQDISNSTEDLLLLSEELKK
SISFFSCDKSV
NT seq 2016 nt   +upstreamnt  +downstreamnt
atgaaaaataagattaaattaagtgtaaaaaaactactgatgacgtttataccattattc
gtaataattcctatatttataatttccatttttaatggaattaaggttaaagacaatgaa
accaggaatttttatgatttaatgagtgcaagtaatggaaagatatctaatataatagct
gatatgtatactaataataaaaagactattgatatgttttctgtaaatgatgatgtagta
ggtttaaaacaaaaaccagaattagaagcatctatgatgaaaacttttaatgattatata
aaatatcatgaagagataagagcaatttactatggagaagcttcaaaagttcatcacaca
acttctggaaaaccaaaacctgggtatgatccaacaagcagaccatggtatacaaaagca
gtacaggaggatggaaaggtagcgttaactgatccttatgaagatgtagttaaaccaggg
acttatgtagttactttggcaaaaacggttaaagaccctaataccaaagaaactttggga
gtaataggaggagacataccattagatactataagcaaggaaatttccaatataaaaata
ggaaatagcggatatacagctgtggtagatcaaacgggtactattattgcacataaggat
aagaaacttgtaagcaaaaaaagcaaggatttaaagtggcttgatgaaataattaaatca
aaagatagcagcaatatagtaaatatagatggacaaaaatacttaaccttaaaatctcaa
aatagtgaaactggatggttaacagtgacttttgtacctaatcaagaattaagtgacaaa
attaaatctttaattatacctaacattatggtaggtttgatatgtgcaattttgggtatt
atagtttcattgtttatatcaaaatatttaataaattctatttatgaaattatagaaatt
cttaagaacataggtaagggaaatttaagtgtacaaatagaatgcagagataatgaacta
aaagaagtatcaatgataaaagaagaaattaatgttatgaaaaaagaaattgtatctatt
acagataaaactatagaggtttctgaaaagctaaatgaatctgcaaagcattttgcttca
gttactcaggaggttagctcatcagcagaagaagtttctggttctgtaagtcaaataaca
gaaggagctgcaaatcaagctgatcacctgcaagaaagttcaaccagtgtggaaactctt
ggagaattagtagataatacattaaaaagtgctaaaagtatggaagaaacttcgggtgaa
gctaataaagttatagaaaacagtatgaaattagttgataacttaaaaaacaatcttgaa
gaagggttccaggttaatgaagaattaataaaagaagcaaaagtgttaaatagcaattca
caagaaatagttggtataataaataatattaaagacatagcagaacaaacaaatttatta
gcattaaatgctggtattgaagctgcaagagcaggggaatacggaaagggttttgtagta
gttgctgaggaagttagaaaattagcagaacagtccactatttttgctgatgaaattgaa
atagtaataggtaaaatgaaaaatagcgtaggaatggtaacagagaagataaaaaataca
aaagaaactaatatgaacacaaaggaaaatatggttacagtagataatggatttgtaaaa
gtagaaaaaaatatagatgaacttaaaaatcatattaacattgtagttgaagcattaaaa
aatataaatgaaaataaaaaagttgtagttacaaagatagaagaagtagcagctatttca
gaagaagctgcagcagctacggaagaagtaaatgcagcatcagaagagcaagctgcaaac
cttcaggatatttcaaattcaacagaagatcttttattattatctgaagaattgaagaaa
tcaataagcttttttagctgtgataagtcagtttaa

DBGET integrated database retrieval system