KEGG   Clostridium carboxidivorans: Ccar_05380
Entry
Ccar_05380        CDS       T03979                                 

Definition
(GenBank) methyl-accepting transducer
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_05380
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_05380
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_05380
SSDB
Motif
Pfam: MCPsignal DUF948 DUF294_C
Other DBs
NCBI-ProteinID: AKN30284
LinkDB
Position
complement(1245644..1247173)
AA seq 509 aa
MNTNTSSIVKYQVQTLKFVIIIYSISALLAGSMFSVMKLLGLYEKVKWPYLLGLFLIGIL
EMIFFKIMYKQTVVDGNLNSKMFKNMKITTVIVCYINYFYMNFTIPSRELWVTVFYMITL
TSLFLDNKINIASIILSIICEIILFTLNPYTLPNEFFLRELILRITSIFLVSFGLFAFTW
FASKLLKSIEQNENELRINNENISNLFNKTSEFAKDLLNSSEALASIASEESATMEEISS
TTQSITKDTDKMLKDSSENTKVLNQLLDANKSISIKAKNTETNSISLINLSTKNEKDLNE
TLNIINSIKNSIDNTLDATKILEKKSKQIDEILLIIKQISEQTNLLALNASIEAARAGEF
GKGFSVVADEIRKLAEDTKTSLNDASLITKDVKERVAQVDYLMTDNSEKVNNGDTIINNA
VENIKIMITELKDSGSDINEISQLTTTLLGETKNVVTFNNNIYETMKETISNFNLVDKSI
NETAAVSEELTSSAENLKDIAAEMNKLIS
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgaatactaatacaagcagtatagttaaatatcaagtacaaacattaaaatttgtaata
attatatattccataagcgcattactagcaggttctatgttttcagtaatgaagctatta
ggattatatgaaaaagttaaatggccttatttactgggtttatttttaataggaatttta
gaaatgattttttttaaaattatgtacaagcaaacagtggtagatggaaatttaaatagc
aaaatgtttaaaaacatgaagataactacagttattgtttgttacataaactatttttat
atgaattttaccattccttcgagagaactttgggtaactgttttctatatgattactcta
acttctctattcttagataataaaattaatatagcctccattatattgagtattatctgt
gaaattattctatttactttaaatccatatacattacctaatgagttttttttaagagaa
ttaatacttagaataacttctatattcctagtttcatttgggctttttgcttttacatgg
tttgcatctaaattattaaaatctattgaacagaatgaaaatgaacttagaataaataat
gagaatataagcaatttatttaataaaacttctgaatttgccaaagatttattaaattca
agtgaagctttagcatccatagcttcagaagaaagtgcaacaatggaagaaatatcaagc
actactcaatctattactaaggatacagataaaatgttaaaggactcttccgaaaatact
aaagtacttaatcaacttttagatgctaataaatctatatctataaaagctaagaatacg
gaaactaattctataagtttaatcaacttatctactaaaaatgaaaaagatctaaatgaa
actctaaatatcataaattctataaaaaacagcatagataatacccttgatgccacaaaa
atacttgaaaaaaaatctaaacaaattgatgaaatacttcttataataaaacaaatatct
gaacaaactaatcttcttgcactaaatgcatcaattgaagctgcaagagctggtgaattc
ggaaaaggattttcagttgttgcagatgaaattagaaaacttgctgaagatacaaaaaca
tcattgaatgatgcctctttaatcactaaagatgttaaagaaagagttgctcaagtagac
tatcttatgactgataactcagaaaaagtaaacaatggcgacactattataaataacgct
gttgaaaatataaagattatgattactgagttaaaggactcaggaagcgatattaatgaa
ataagtcaattgactactacccttctaggagaaactaaaaatgttgttacatttaacaat
aacatttatgaaactatgaaagaaaccatatcaaatttcaatttagttgataaatcaata
aatgaaactgcagcagtaagtgaagaattgacaagcagtgcggaaaacttaaaggacata
gctgctgaaatgaataaattgatttcataa

DBGET integrated database retrieval system