KEGG   Clostridium carboxidivorans: Ccar_05770
Entry
Ccar_05770        CDS       T03979                                 

Definition
(GenBank) histidine kinase
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_05770
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_05770
Two-component system [BR:cck02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   Ccar_05770
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ccar_05770
SSDB
Motif
Pfam: Response_reg
Other DBs
NCBI-ProteinID: AKN30355
UniProt: C6PPN2
LinkDB
Position
1349792..1350154
AA seq 120 aa
MKKVLIVDNSSYMRMFVKKIIEKGGFPSTFEASGREDAIEIFKAEKPDIVLLDLNMSEFK
MDGMHVLSDIMEADSEAVVIIMSAVGHEEVKDECIAAGAKGYIKKPFTTETLLKALEEYK
NT seq 363 nt   +upstreamnt  +downstreamnt
atgaaaaaggtattaatagttgataattcgtcatatatgagaatgtttgtgaaaaaaatt
attgaaaaaggaggctttcccagcacctttgaagcatcagggagagaagatgcaatagaa
atattcaaagctgaaaaaccagatattgtactcttagatttgaatatgtcggagtttaaa
atggatggtatgcatgtattaagtgatataatggaagctgattctgaagcagttgtaatt
atcatgtcagcagtaggacacgaagaagtgaaggatgaatgtatagcagcaggagctaaa
ggttatattaagaaaccttttactactgaaactttattgaaggcattagaagaatataaa
taa

DBGET integrated database retrieval system