KEGG   Clostridium carboxidivorans: Ccar_06015
Entry
Ccar_06015        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_06015
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_06015
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_06015
SSDB
Motif
Pfam: MCPsignal dCache_1 HAMP dCache_2 sCache_3_3 DUF1043 DUF1664 REF DUF3739 EF-G-binding_N DUF948
Other DBs
NCBI-ProteinID: AKN30398
UniProt: C6PQL2
LinkDB
Position
1396971..1398959
AA seq 662 aa
MKKVQSKLTLQIFLLVLIICGVLSFGTYYISSSSLNETVKTNLIERTDDVSKLLSNYMKN
EQTALNGLVALNEVKSGNWEIQKPILIEESKKFGFEKLGIVDLNGKAHTTLNDNELDVSK
IEYVKKALNGETGFSDATKSKVNGSLIMDAYAPIKGSDGKTIGAMIGTLDVQKVSTFLQG
MKFSNSVYPYVINKEGTVILHKDIEVVKKEDNSIKNAEKDSSYKELGNYIKKVITGETGY
GEYKYKGLEKIISYAPVSGLNWFIVVEADKSVLFNSIQHLKLMALIATIIFILVGLIFGL
FIAKSITKPLLKIRNLAERLSQYDFSNETHMLRKDEFGETAAALNTAQENIKILIKKIMD
GAQDMSAASEELSATSEELASRFEHINMSTEDIVKIAQKANSSTGNVTVSIEEIDSSIMK
LSNKAMDGSNNSNESKDRAISVQKNAKNAISESRNIYKDKEEKILKAIESAKVVGEVKTM
ADAIASISEQTNLLALNAAIEAARAGEHGKGFAVVAEEVRSLAEQTSETVYTIQDTIEKV
QEAFKNLADNGSELLKFIDENVNKQFDSYLNTGEQYYKDSEYVSGMAEDLSSMAQQITAS
VNQVTNSIQSMAEDSEKSSASTNEIKDSIQDASLAMEQIAKTAQSQAQLAQELSGIVHKF
KI
NT seq 1989 nt   +upstreamnt  +downstreamnt
atgaaaaaggttcaaagtaaattaacattacaaatttttttattggttttaataatatgt
ggagttctaagttttggaacttattatatttcatcaagttcattaaatgaaactgtaaaa
acaaacttaatagaaaggactgatgatgtttctaagcttttatcaaattatatgaaaaat
gaacaaactgcactaaatgggcttgtagctttaaatgaagtaaagtcaggaaattgggaa
attcaaaaacctatattaatagaggaaagtaaaaaatttggttttgaaaaattagggata
gtagatttaaacggaaaagcgcataccactttaaatgacaatgaactagatgtatcaaag
atagaatatgtaaaaaaagctcttaatggtgaaacaggtttttctgatgctacgaaaagt
aaagtaaacggatcactcattatggatgcatatgctccaataaaaggaagtgatggcaaa
actataggtgccatgattggaacattagatgtgcaaaaggtgagtacttttttacaagga
atgaaattttctaattcagtatatccttatgtgataaataaagaaggaacagtaatttta
cataaagatatagaggtagtaaaaaaagaggataattctattaaaaatgctgaaaaagac
tctagttataaagaactaggtaattacatcaaaaaagtaatcactggtgaaactggatat
ggagaatataaatacaaggggctagaaaaaattatttcttatgctcctgtaagtggatta
aattggtttatagtggtagaagctgataaatcagtattatttaattccatacagcactta
aaattaatggcactcattgctaccataatttttatattggtaggattaatttttggatta
tttatagctaaatccataacaaagcctttactaaaaattagaaatttagcagaaaggctt
tcacaatatgatttttcaaatgaaacgcacatgttaagaaaagatgaatttggagaaact
gcagcagctcttaatactgctcaggaaaatataaaaatattaattaaaaagattatggac
ggagcacaggatatgagcgctgctagtgaagaattatctgcaacttctgaagaacttgct
tcaagatttgaacatataaatatgtcaactgaagatatagtaaaaatagcccaaaaagct
aactcatcaacaggaaatgttacagtttctatagaagaaatagattccagtataatgaaa
ctttcaaataaagcaatggatggaagtaataattcaaatgaatctaaagatagagctatt
tcagtacaaaaaaatgctaagaatgctatatctgaaagtagaaatatttataaagataaa
gaggaaaagattttaaaagctatagaatcagcaaaagttgtaggagaagtaaagacaatg
gcagatgcaatagcaagcatttctgagcaaactaatctattagcattgaatgcagcaata
gaagcagcaagagcaggagagcatggtaaaggttttgctgtagttgctgaagaggtaaga
agtttagctgaacaaacttcagaaaccgtttatacgatacaggatactatagaaaaggta
caagaagcatttaaaaatcttgctgataatggcagtgagttgttaaaatttattgatgaa
aatgtaaataaacaatttgactcatatttaaatacaggagaacaatattataaggattca
gaatatgtgtcaggaatggctgaggatttatcatccatggctcagcagattacagcatca
gtaaatcaggtaaccaattcaattcaaagtatggcagaggattcagaaaaatcatctgca
agtacaaatgaaataaaagatagtatacaggatgcatcacttgctatggaacagatagct
aaaacagcacaaagtcaagctcaattagcacaggaacttagtggaatagttcataaattt
aaaatataa

DBGET integrated database retrieval system