KEGG   Clostridium carboxidivorans: Ccar_07830
Entry
Ccar_07830        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_07830
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_07830
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_07830
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_07830
SSDB
Motif
Pfam: MCPsignal HAMP 4HB_MCP_1 Crescentin DUF948 TarH DUF1201 DUF5798
Other DBs
NCBI-ProteinID: AKN30750
UniProt: C6Q1N2
LinkDB
Position
complement(1803351..1805039)
AA seq 562 aa
MNLKIRSKLILAFGVILVCFLLNIVISISFLNNNDKSISKVRNFTYKQLKYSSNINVSVI
EVQQFLSDASATKNMDSLKEAEKCKATFKDSLKQLESINPNIKSETEKIDKDFDKFYELG
VNMANVYIKEGPDKGNVLMTQFDPMATNLSNEINSLNDNAEASMNSDLQNIQSTMTRNKV
FSIVLGSFSLILAVIVIILLQGSILKPINSMFAILKDIENGQGDLSKRIKIKSDDEIGIM
AKSFNNFMDQLVSMIENIKENSILVSKSSEVLNEGAEKSIESIRQINENMIELDNGSENI
SSSVSEVAASSSNIAESTQITAEEVENISIMTEEINNIAMESGKFVKSTREEMNKIESIS
SANMVINEKLGAKAEEIRNIIDTIKSISDQTNLLALNASIEASRAGEHGKGFAVVADEIR
ELSENNNESSKSIENIIEGINEMIKNTIDSAAQEASNIKKGNKMVEEVVIQIEKIIEGIN
NINSKIQSIAASAQEQSASIEELTSTMEAVSNSNAEMSAEIKSVSNGVQSQADIISEFAE
MAENLSNSSNQLNNLVNKFKIK
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgaatttgaaaataagatcaaaattaattttggcatttggagtaattttagtatgcttt
ttgcttaatattgtaatcagtatcagtttccttaataataatgataaaagtataagtaaa
gtaagaaattttacatataaacaattaaaatattcatctaatataaatgtttcagtaatt
gaggttcagcaatttttatcagatgcttctgctactaaaaacatggacagccttaaagag
gctgaaaaatgtaaggcaactttcaaagattcattaaagcagcttgaaagcataaatccc
aatattaaaagtgaaactgaaaagatagataaagattttgataaattttacgaacttgga
gtaaacatggcaaatgtttatataaaggaaggtcctgacaagggtaatgtattaatgact
caatttgatcctatggcaactaatttgtctaatgaaattaattcattaaatgataatgct
gaagcttccatgaattcagatttacaaaacatacaaagcactatgactaggaacaaagta
ttttcaatagtattaggaagtttttctttaattctagcagttatagttataatattgtta
caaggtagtattttaaagccaattaacagtatgtttgctatacttaaggatatagaaaat
ggacaaggagatttaagtaaaagaataaaaataaaatctgatgatgaaataggtataatg
gctaaatcctttaataattttatggatcaactagttagcatgatagaaaatataaaagaa
aattctattcttgtatcaaaaagctctgaagtactaaatgaaggagctgaaaaaagtata
gaaagtataaggcaaataaatgaaaatatgattgaattggataatggaagtgaaaatatt
tctagttcagtaagtgaagttgctgcaagttcttctaatattgcagaatcaacacaaatt
acagctgaagaggttgaaaatataagcataatgacagaagaaattaataatattgctatg
gaaagtggtaaatttgtaaagagcactagagaagaaatgaataaaattgaaagcatctcc
tcagccaatatggttataaatgaaaaattaggagctaaagcagaagaaattagaaatata
attgatactattaagtcaatatcagatcaaactaacttgctagctttaaatgcttctata
gaagctagcagagcaggagaacatggcaaaggttttgcagtagtggctgatgaaataagg
gagctttctgaaaataacaatgaatcctctaagagcattgaaaatataatagagggtata
aatgaaatgataaaaaatacaatagattcggcagcacaagaagcatctaatataaaaaag
ggaaacaaaatggttgaagaggtagttatacagattgaaaagattatagaaggaataaat
aatataaacagtaaaattcaaagtatagcggcatcggcacaagagcaaagtgcttcaatt
gaagagcttacatctactatggaagctgtaagtaatagtaatgcagaaatgtcagctgag
ataaagtctgtatctaatggtgttcaatcacaagctgatataatatcagaatttgcggaa
atggccgaaaatctaagcaattcatcaaatcaattgaataatttagtgaataagtttaaa
attaagtaa

DBGET integrated database retrieval system