KEGG   Clostridium carboxidivorans: Ccar_08060
Entry
Ccar_08060        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein CheV
  KO
K03415  two-component system, chemotaxis family, chemotaxis protein CheV
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_08060
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_08060
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cck02022]
    Ccar_08060
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_08060
Two-component system [BR:cck02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   Ccar_08060
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ccar_08060
SSDB
Motif
Pfam: CheW Response_reg
Other DBs
NCBI-ProteinID: AKN30794
UniProt: C6PWM5
LinkDB
Position
complement(1864054..1864965)
AA seq 303 aa
MNTNILLESGTGEVEILEFVVNNKHYAINVIKVKEVLEVDNLTKLPQSHPAIGGLILCRD
EIITLINLKYILEKQSEIEEKSKVIISEFNKVKVGFNIDDILGVHRIRWEQIMKPDDISA
NSLVIGNIVLDNKIILLLDFEKIVTDINPSTGISEDKIVKVDYKDRSNVKIVLADDSALI
RKLLKDTLTKAGFKNLLMFDDGKQALDYLTNLVEEKKDKFIDDVQMLITDIEMPQMDGHT
LTRKVKEHPLLKKLPVVIFSSLITGDLKHKGISVGADAQLSKPEVGELVNVIDDFTERIK
ANK
NT seq 912 nt   +upstreamnt  +downstreamnt
atgaacacaaatatattattagaaagtggtactggagaagttgaaatactggaatttgta
gtaaataataagcattatgcaattaatgttataaaagttaaagaagtattagaagtagat
aatttaaccaaattgccacaatcacatcctgcaataggcggacttatattatgtagagat
gaaataataacattaataaatttaaaatacatattagaaaaacaaagtgaaatagaagaa
aaatctaaagttataatatctgaatttaataaagttaaagtaggctttaacatagatgat
attttaggagttcatcgtattagatgggaacaaataatgaaaccagatgatatatctgca
aattccttagtaataggaaatattgttttagataataagataatattattgcttgatttt
gaaaagatagttacagacattaatccaagtacaggtataagtgaagacaaaattgtgaaa
gtagattataaggatagatcaaatgttaaaatagtattagcagatgattcagcattaata
agaaaattattgaaggatacgcttactaaggctggatttaagaatttattaatgtttgat
gatggtaaacaagctttagactatttaacaaacttagtagaagaaaagaaagataaattt
atagatgacgttcaaatgttgattacagacattgaaatgccacagatggatggacatact
cttacaagaaaagttaaggagcatcctcttttgaaaaaattgccggttgtaatattctca
tcattaataacaggtgatttgaaacataaaggaatttctgtaggtgctgatgctcagttg
agcaaaccagaagtaggggagttagtaaatgttatagatgattttacagaacgtataaaa
gcaaataagtaa

DBGET integrated database retrieval system