KEGG   Clostridium carboxidivorans: Ccar_08660
Entry
Ccar_08660        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_08660
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_08660
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_08660
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_08660
SSDB
Motif
Pfam: MCPsignal DUF948 Laminin_II Baculo_PEP_C RmuC DUF745 DUF1664 CheZ EzrA Sec34 Fzo_mitofusin Filament TMPIT Transcrip_act Syntaxin-6_N Dor1 GOLGA2L5 T7SS_ESX_EspC Latarcin SKA2 CALCOCO1 Fib_alpha Mating_N Laminin_I TPR_MLP1_2 Mce4_CUP1
Other DBs
NCBI-ProteinID: AKN30908
UniProt: C6PMY2
LinkDB
Position
complement(2014990..2015982)
AA seq 330 aa
MLELFRKNKKIDVEVSSSDNNEKEIKSIDDISEQQCINYSLSYIQERMSNLMDSEINISK
TVNDVSRTFNQVSGSIDKIGNVLDNFNDNFNHFAESSSNIDTATDDSIKALDNANIMMAD
LKSKMHNIEKSMNEFANTFFILKSSFKDIGKLSNSISDVANETNLLALNANIEAARAGEA
GKGFAVVAEEVRKLADSTKELVDGINKKMAEMDNNVENLSSSVEYSKSALKEGVDSTEKT
QEAFSSILSSSKHVKEKTGEINNSVSVTQKGLKEISNDINEIMNSSKDVNTEIVDLNIQS
SEKSIIFSDIINFLEQLDTISIEKMNALKK
NT seq 993 nt   +upstreamnt  +downstreamnt
atgcttgaattatttagaaaaaataaaaaaatagatgttgaagtaagtagtagtgataat
aatgaaaaagaaataaaatcaattgatgatattagtgaacaacagtgtattaattatagt
ttaagttacatacaagaaagaatgtctaaccttatggatagtgaaattaacatatccaag
acagtaaatgatgtttcaagaacctttaatcaggtatctggaagtatagataaaattgga
aatgtattagataattttaatgataatttcaaccattttgcagaaagttcaagtaatata
gatacggctacagatgattctataaaggctctagataatgcaaatattatgatggctgat
ttaaaaagtaaaatgcataatatagagaagagtatgaatgaatttgcaaatacatttttt
attcttaaaagttcttttaaagatataggtaagctatcaaacagcattagcgatgtagct
aatgaaacaaatcttcttgcattaaatgcaaatattgaagctgcaagagctggagaagca
ggaaaagggtttgctgttgttgcagaagaggttagaaaactagcagattcaactaaagaa
ttggtagatggtataaataaaaaaatggctgaaatggataataatgttgaaaacctttct
agttctgtagaatattcaaaatcagctttaaaggagggagtagattcaactgaaaaaact
caggaagctttttcaagtattcttagttcctcaaagcatgtaaaagaaaagacgggagaa
attaataattctgtaagcgttacccaaaaaggacttaaggaaatatcaaatgacataaat
gaaataatgaattcctcaaaggatgtaaatactgaaattgttgacttaaatatacagtcg
tctgaaaaatcaataattttttcagacataattaattttttagaacaacttgatactatt
tccatagaaaagatgaatgcattaaaaaagtag

DBGET integrated database retrieval system