KEGG   Clostridium carboxidivorans: Ccar_08810
Entry
Ccar_08810        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_08810
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_08810
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_08810
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_08810
SSDB
Motif
Pfam: MCPsignal dCache_1 Cache_3-Cache_2 dCache_2 HAMP TMP_2 sCache_3_2 Cadherin_C_2 DELLA DUF4492 Laminin_II Lipoprotein_7
Other DBs
NCBI-ProteinID: AKN30938
LinkDB
Position
2051544..2053529
AA seq 661 aa
MKKRNSLQLKAICIISFIFILIISILTVICYNNSKKSILNSMESSGKQTVTIHAQDLSSW
VNSRLSQMQVIANTELVSSMNYDKILPYFQREQKNYNGIYNTLGIGDTSGKLILQNGTVI
DISSESTFSLVMQGKSVISNPFSAKQSPSDWIISMECPVKDTGTNNVIGVVSGACLVSTV
FKETTNFHLGKTDKVYILNKDGTVLFHPDNKLINTSNFLKSSNSQYASLVKQAVSQNSFS
GEFKDNTETKMLFSSHVDGTDWYMFLEVPTNEYISGINSLLYSTSILAIISIILLIIILT
FLTKYFFNRLLNVSTAAERVADGYLVNYLPETPDELGTFNATFNKMVKNLKDIVLKLRNV
SNIVSSSSKNYKEIGFKVAESAKCIQENITDLASGSKVAASEISNVTKYIGDMEKQSKSL
VDISVNIDAMILEAKNNVSDGSHNLNSTMDLLDNMKNSILNSSKVITKLSDGSKNIENIT
TSISSISDQTNLLALNASIEAARAGEHGKGFSVVAEEIRKLAEQSSTSTEEISREISEIQ
KQILEASSTMKDSINYMESGTSSMETISDVFSKIANKIEKIKNVSSDVSEIAKKLLNENI
NIHKAISNVSSISEEAAANTSSTEEIVNDQEKMFLELKTASKELEDLSILLSNEISKFKI
D
NT seq 1986 nt   +upstreamnt  +downstreamnt
atgaaaaagcgaaattcactacaacttaaggcaatttgtataatatcttttatttttatt
ttaataataagtattcttaccgttatttgttataacaattcaaaaaaatcaattttaaat
tctatggaaagctctggcaaacagacagttactattcatgctcaagacttgtcttcttgg
gtaaattcaagattatcacaaatgcaggtaattgcaaatacagaattggtatcaagtatg
aattatgataaaatactaccttactttcagcgtgaacaaaaaaattataatggaatttat
aatactttaggtattggtgatacaagcggaaagctaattttacaaaatggaactgtaatt
gatataagttctgaaagcactttttctttagtgatgcagggtaaatcagttatatcaaat
ccatttagtgccaaacaaagcccttctgattggattatatctatggaatgtcccgtaaaa
gatacaggaactaataatgttattggtgttgtaagcggtgcttgccttgtttctacagtg
tttaaagaaactactaattttcatttaggaaaaacagataaagtgtatatacttaataaa
gatggtactgtattattccatccagacaataaactaattaatactagtaactttctaaaa
agctccaacagtcaatatgcaagtttagttaaacaagctgtttctcaaaatagtttttct
ggagaatttaaagataatactgaaacaaaaatgcttttttcatcacacgttgatggaacc
gattggtacatgtttctagaagtacctactaatgaatatattagtggcataaactcctta
ttatattcaactagtattctagcaattatttcaataattttattaattataatactaact
tttttgacaaaatacttttttaacagattattaaatgtatctacagctgctgaaagagta
gctgatggatacctagttaactatttacccgaaaccccagatgaattaggaacatttaat
gctacttttaataaaatggtaaaaaatttaaaggacatcgtattaaagttaagaaatgtt
tcaaacattgtttcatcatcttctaaaaattataaagaaattggctttaaagttgctgaa
agcgctaaatgtattcaagaaaacattacagatttagcttcaggttctaaagtagctgct
tctgaaatttcaaacgttaccaaatatattggtgacatggaaaagcaatcaaaaagtcta
gtagatataagtgtaaatattgacgccatgatattagaggccaagaacaatgtatctgat
ggttcccacaatttaaattctacaatggacttattagacaatatgaaaaatagtatatta
aattctagtaaagttataacaaaactttctgatggatctaaaaacattgaaaatataaca
acttcaataagctctatatcagatcaaacaaatttattagctctaaatgccagtattgaa
gctgcaagagctggcgagcatggtaaaggtttttctgtagtggcagaagaaattagaaaa
ttagctgaacaatcttctacctcaactgaagaaatatctagagaaatatctgaaatacaa
aaacaaatattagaagcttcatcaactatgaaagacagtataaattatatggaatcaggt
acaagctctatggaaactatttcagatgtattctctaaaatagccaataaaattgaaaaa
ataaaaaatgtcagttctgatgtatctgaaattgcaaagaaactgctaaatgaaaatata
aatattcataaagctatttcaaatgtttcttcaataagtgaagaagctgctgccaatacg
tcatctactgaagaaatagtaaatgatcaagaaaagatgtttttagagcttaaaactgct
tcaaaggagctagaagatctttcaatactattgtcaaacgaaatttctaaatttaaaatt
gactag

DBGET integrated database retrieval system