KEGG   Clostridium carboxidivorans: Ccar_09960
Entry
Ccar_09960        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_09960
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_09960
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_09960
SSDB
Motif
Pfam: MCPsignal DUF948 Fib_alpha T4SS_CagC DUF1484 SKA2
Other DBs
NCBI-ProteinID: AKN31155
UniProt: C6PX25
LinkDB
Position
2307342..2309090
AA seq 582 aa
MKKWKLNNIKLSVKMIFSLIVPIASLILISCISIKYINQIHNGLIKNIYEETHMSEYWLL
NADRDFYQALTAQMGMENTSDPKALKDAKSSYLENQKQTIDRVHKARDIIYSDKTKFENM
KHKDSKLTLIQLFDSFDKDFSNWSNLFDPDKNVLTNKAEYLKNFDMARERINQIEEIMDD
YNSRVISENRSLVNSITNIVIIVSLCTIFLSILLGLYLIINIKKRTNVSIALMKKTAKFD
LKYDKSYEKYLSEKDEFAEIINAESSIRREFSSIIKKVTEETIVLNDAIKIVNENIFSLK
DEIEDISSTTEELSAVMEETAASTQETTAASSEIEKHIEDISSKAVLGSKSVESINERAS
KLKNDFSISHNNTLEMLNMVKEKLKKSLTQSKSVNQINELSNSILEITSQTNLLALNASI
EAARAGEAGKGFAVVADEIRNLAETSRTSVNQIQEITKVVIDCVESLTNNSNELLKFVET
DVTCDYKTMLDATDQYKLDADLVNDLVDNFSSTSKELVSSVENIVTTMSGIAEATNEGAL
GTSNIAEKVSSVVSKANEIKESINSTEEGFKALNDMISKFNV
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgaaaaaatggaaattaaataatattaagctgagtgtaaaaatgatatttagtctaata
gttcctattgcttcactaatattgatttcatgtatttctataaaatacataaaccaaatt
cacaatggattgataaaaaatatatatgaagaaacacacatgagcgaatattggctgctt
aatgcggatagagatttttatcaagcattaactgctcaaatgggaatggaaaatacctca
gacccaaaagctttaaaggatgcaaaatcctcttatttagaaaatcaaaaacaaactatt
gatagagtccataaagcacgagacataatatatagtgacaaaactaagtttgaaaatatg
aagcataaagattcaaagttaacattaattcaattatttgattccttcgataaagatttt
tccaattggtcaaatctttttgatcctgataaaaatgtattaaccaacaaagcagaatat
cttaaaaattttgatatggcaagagaaagaataaatcaaattgaagaaataatggatgat
tacaattccagagtaattagtgaaaatcgctccctagtaaattctattacaaatatagta
attattgtttcattatgtacaatttttctttcaattttgctaggattgtatttaattatc
aacataaagaaaagaactaatgtatccatagcattgatgaaaaagacagcaaaatttgat
ttgaaatatgataaaagttatgaaaaatatttatcagaaaaagatgaatttgcagaaatt
atcaatgcagaatcaagtatcagaagggaatttagcagtattataaagaaagttactgaa
gaaactatagtcttaaacgatgctattaaaatagtaaatgaaaatatattttctcttaaa
gatgaaatagaagatatatcctccaccacagaagaactgtctgctgtcatggaagaaaca
gccgcatctactcaagaaacaacagctgctagttctgaaatagagaaacatattgaagat
atttctagcaaagctgtgttaggttcaaaatcagttgaaagtataaatgaaagagcttct
aaattaaaaaatgatttttcaatatctcacaataatactttagaaatgcttaatatggta
aaagaaaaattaaagaagtctttgacacaatctaaatctgtaaatcaaattaatgaatta
tctaattccatactagaaataacttcgcaaacaaacctattagcacttaacgcttctata
gaagctgcaagagctggtgaagcaggaaaaggttttgctgttgttgctgatgaaataaga
aatcttgcagaaacttcaagaacatcagttaatcagattcaagaaataacaaaagtagtt
attgattgtgtagaaagtttaaccaataattcaaatgaactgcttaaatttgtagaaacc
gatgttacctgtgactacaaaacaatgttagatgccacagatcaatataaacttgatgct
gacctagtcaatgatttagtagacaactttagttcaacctctaaagagttagtatcatcc
gttgaaaatatagtaacaactatgagcggtatagccgaagccacaaatgaaggtgcactt
ggtacaagcaatattgctgaaaaagtatcctctgtagtaagtaaggcaaatgaaataaaa
gaaagtattaattccactgaagaaggttttaaagctctcaatgatatgatttcaaaattc
aatgtataa

DBGET integrated database retrieval system