KEGG   Clostridium carboxidivorans: Ccar_10175
Entry
Ccar_10175        CDS       T03979                                 

Definition
(GenBank) amine oxidase
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
cck  Clostridium carboxidivorans
Pathway
cck00260  Glycine, serine and threonine metabolism
cck00330  Arginine and proline metabolism
cck00340  Histidine metabolism
cck00350  Tyrosine metabolism
cck00360  Phenylalanine metabolism
cck00380  Tryptophan metabolism
cck01100  Metabolic pathways
cck01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cck00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ccar_10175
   00330 Arginine and proline metabolism
    Ccar_10175
   00340 Histidine metabolism
    Ccar_10175
   00350 Tyrosine metabolism
    Ccar_10175
   00360 Phenylalanine metabolism
    Ccar_10175
   00380 Tryptophan metabolism
    Ccar_10175
Enzymes [BR:cck01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     Ccar_10175
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox_2 DAO GIDA AlaDh_PNT_C FAD_binding_2 FAD_binding_3 Pyr_redox HI0933_like NAD_binding_9 Pyr_redox_3
Other DBs
NCBI-ProteinID: AKN31197
UniProt: C6PY12
LinkDB
Position
complement(2356087..2357766)
AA seq 559 aa
MEVYRADIQPFNPSNEQRYALLKNALRKSGRLGDFNNIIKLLGPPPDILNYAYPGEFKKI
KVGIIGGGLAGMSAAFELRKLGFDITVFDALKDRVGGRVYTYYFDEDKKFYGELGPIRIP
VAHETTWHYINLFGLATQPFIQNNPNNFVYVQETRARRDPKSIEKKIYPKYNLRQIEKNT
TWPKLYEYAVHFFMNKLRPEIRAEILKILPKYNPSYNTLLNISIRQNFEMLGLSPDAIDM
IASVDAFTGALIDLSYNEVLQEDYPENFSYLYRVAGGNVNLPIAFYKSLTSKVPKEYRIP
QNELGKVTWKGGSQVLGIYKTENEKKVVLRYQGNNIKGETTEGFDYVICAIPFTTLSTMD
IAPFFSNRKMQAIREINYVDGHRTLLLCKKRFWEENADYGRIVGGVSNTDLSITNILYPS
DHVMTGANPNEPGVLIGSYNLNKYATHIGAIKGDAHFQQVKRQVEQVHGLPRNYLDSIVT
QSKFIHWNNEEWFRGAVAFFTPEQKRIFSHNILKPEYDNRVFFAGEHTSATHGWMQGALS
TGKLAANSLVRSVKAERKM
NT seq 1680 nt   +upstreamnt  +downstreamnt
atggaagtatatagagctgatattcaaccattcaatccatctaatgagcaaagatatgca
ttgttaaaaaatgcattacgcaagtcaggtagactaggtgactttaataacattattaag
cttttaggtcctccgccggatattttaaattatgcatatccaggtgaatttaagaaaatt
aaggtaggtattataggtggaggtcttgctggtatgtcagcagcttttgaacttagaaaa
cttgggtttgacataacagtgtttgatgctctaaaagatagagtgggtggaagagtatat
acttactattttgatgaagataaaaagttttatggggaacttggtccaattagaattcca
gtagcacatgaaactacctggcattatattaatctttttggacttgctacgcagccattt
attcaaaacaatcctaataactttgtatatgtacaagaaacaagagctagaagagatcct
aaaagcattgaaaaaaaaatatatccaaaatataatttaagacaaatagaaaaaaataca
acctggcccaaactttatgaatatgcagtgcatttttttatgaataagctgcgtccagaa
ataagagctgaaattttaaaaattcttcctaaatataatccaagttataatactttactt
aatattagcatccgtcaaaattttgaaatgctggggcttagtcctgatgctatagatatg
atagcaagtgttgatgcatttacaggtgcactaattgatttatcctacaatgaagtactg
caggaagattatccagaaaatttttcttatctttacagagttgctggtggcaatgtaaac
ttgccaattgcattttacaagtctctaacatctaaagtacctaaagaatatagaattcct
cagaatgaactgggaaaggtgacctggaaaggcggcagtcaggtattgggaatatataaa
actgaaaatgaaaaaaaggttgtattgagatatcaaggaaataatattaaaggagaaact
acagaaggatttgactatgttatttgtgccatcccatttacaacactttcaactatggat
attgcacctttctttagtaatagaaaaatgcaggcaataagagaaataaattatgtggat
ggacatagaactctactactatgcaaaaagcgtttttgggaagaaaatgcggattacgga
aggattgtaggtggcgtgtctaatactgacctatctataacaaatatattatatccttca
gatcatgttatgactggagctaacccaaatgaaccaggagtattaataggttcatacaat
ttaaacaaatatgctacacatataggggctataaagggagatgcacacttccagcaagtt
aaaagacaggttgagcaagttcatggtcttcctagaaattatctagattctatagtaaca
cagtcaaaatttatccattggaataatgaagaatggtttagaggagccgtggcatttttt
acaccagaacaaaaaagaattttttcacataatattttaaaaccagaatacgataatagg
gtgttctttgcaggagaacatacctctgcaacccatggttggatgcagggggctctatcc
accggaaaattagctgccaacagtttagttcgcagtgttaaggctgaaagaaaaatgtaa

DBGET integrated database retrieval system