KEGG   Clostridium carboxidivorans: Ccar_12625
Entry
Ccar_12625        CDS       T03979                                 

Definition
(GenBank) hypothetical protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_12625
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_12625
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Ccar_12625
SSDB
Motif
Pfam: MCPsignal dCache_1 Cache_3-Cache_2 HAMP sCache_2 dCache_2 sCache_3_2 DUF948 Cation_ATPase_C Apolipoprotein
Other DBs
NCBI-ProteinID: AKN34169
LinkDB
Position
complement(2880397..2882346)
AA seq 649 aa
MLIMIVIGIAPIISLGIFSNIKTDSIVRNRFEVSTSQTIQEVNRGIENFFEGMSTPLIFM
DNNSYIKEIKTHPENVLILNSIFKDVKASNECIESVIFGLPDKTVYVYPESSNTLDPTTR
PWYIGAMAKRGKVFYSDPYVGLLTKKNLVTISMTVENNNQVIGVIGVTINLDKLSNKLSS
IKIGQKGYIYVTDSKGILVAHPDKKLIGTDTIKKLSIWEMAKNRESGFQKDNSKNANNII
IYDTNKLTNWKLFASMPNSEINDDLNYLKKYSIVFIFIMLVLSGIAALIVSRRITKNIFK
LQNAFNKAAYGDLSIRTDINSKDEFGKLGNDFNKMVEGIGTLICNVKESADILNENSDTI
TSMAKESDDAVKEVAATIGQIADGTSDQSMNVDEGVRELEQVSNKIYNISELTNKMSNES
ENTNRLSKKGLEVVKILTEKSVNTDKSTMDVNDIVLDVHKSSNEISVITDTINQISSQTN
LLALNAAIEAARAGEAGKGFSVVADEIRKLAEESTSATEQIQALVGSIRGKAQTAVKAME
ETKNSVKEQNSAVSETRTIFGEILTSINKLTSQIQLVKEKAEETINNKDEIVAKMQNISA
VSEEIAASTEEVSASGEEITATMDEFLTNANSLKQLSIELEAQINKFKL
NT seq 1950 nt   +upstreamnt  +downstreamnt
atgcttattatgatagttatcggtattgcgccaataatatctttaggcattttctctaat
attaaaactgacagtattgtgagaaataggtttgaagtttcaactagccaaacaattcaa
gaagttaatagaggcatagaaaacttttttgaaggaatgtctacacccttgatatttatg
gataataattcatatataaaagaaataaaaacacatccggagaatgtattaatattaaat
tctatttttaaggatgtaaaagctagtaatgaatgcattgaaagtgttatatttggattg
ccagataaaacagtatatgtatatcctgaaagtagtaatacactagacccaacaaccaga
ccttggtatataggtgccatggctaaaaggggaaaggtattttactctgatccatatgtt
ggtttattgaccaagaaaaatctggtgacaatttccatgactgttgaaaataataatcag
gtaattggagttataggagtaactataaatcttgataagttatccaataaactatcaagt
ataaaaattggacagaaaggttatatatatgtaactgattcaaagggtattctagtagct
catcctgataaaaagttaataggtacagatacaataaaaaaattgtcaatatgggaaatg
gcaaaaaacagagaatcaggatttcaaaaagataattctaaaaatgccaataatattatt
atttatgacacaaataaattgaccaattggaagttatttgcgtcgatgcctaactctgaa
ataaacgatgatcttaattatttaaaaaagtattcaattgtatttatttttataatgctt
gtactttcgggaatagcagcattaattgtgagcagaaggatcactaaaaacatatttaaa
ttacaaaatgcatttaataaggcagcctatggtgacttgtcaattcggacagatattaat
agcaaagatgagttcggaaaattaggaaatgattttaataaaatggtagaaggtatagga
acattgatatgtaatgttaaagaatccgctgatattttaaatgaaaattcagatacaata
acttcaatggctaaggaaagtgatgatgctgttaaagaagtggcagcaacaataggtcaa
attgcagatggaacttcagatcagtcaatgaatgtagatgaaggagttagagaattagaa
caggttagcaataaaatatataatatttctgaacttacaaataaaatgtctaatgaatca
gaaaataccaataggttaagtaaaaaaggattagaagtagttaaaattcttactgaaaaa
tctgtcaatactgataaatctacaatggatgttaatgatattgtattagatgtacataaa
tcatctaatgaaattagtgttattactgatactattaatcaaatatcatcacaaactaac
ttgttagcattaaatgctgcaatagaggcagcaagagcaggtgaggctggtaaaggattt
tctgtagtggcagatgaaattcgtaaacttgctgaagaatctacttctgcaactgaacag
attcaagcattagttggtagtattagaggaaaagcacaaacagcagttaaagcaatggag
gagacaaagaacagtgtaaaagaacagaatagtgctgtttctgaaacaagaactatattt
ggagaaatattaacttcaataaacaaattaacttcgcaaattcaattggtgaaggaaaag
gcagaagaaactattaataataaagatgaaatagtagctaaaatgcaaaacatatctgca
gtttcagaagaaattgctgcaagcacagaagaagtttcagcatctggggaagagattaca
gcaacaatggatgaattcttaaccaatgcaaattctttaaaacaattatcaatagaactt
gaagcacaaatcaataaatttaagttataa

DBGET integrated database retrieval system