KEGG   Clostridium carboxidivorans: Ccar_12725Help
Entry
Ccar_12725        CDS       T03979                                 

Definition
(GenBank) aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cck  Clostridium carboxidivorans
Pathway
cck00030  Pentose phosphate pathway
cck01100  Metabolic pathways
cck01120  Microbial metabolism in diverse environments
cck01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cck00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ccar_12725
Enzymes [BR:cck01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Ccar_12725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AKN31676
UniProt: C6PXF4
LinkDB All DBs
Position
complement(2903437..2905260)
Genome map
AA seq 607 aa AA seqDB search
MYGYNGKVLRINLSNKTYVVEELKIDQAKKFIGSRGLGVKTLFDEVDPKIDPLSPDNKFI
IAAGPLTGAPVPTSGRFMVVTKSPLTGAIAISNSGGKWGVELKMAGYDMIIVEGKSDKEV
YVNIVDDKVEFKDASHVWGKLTEETTKMLQNENDAKAKVLCIGPAGEKLSLMAAVMNEVD
RTAGRGGVGAVMGSKNLKAIVVKGSGKVKLFDEEKVKAVSLEKSNILRKDPVAGSGLPTY
GTAVLVNIINENGIHPVKNFQESYTPEADKISGETMTKDCLVRKNPCYRCPIACGRWVKL
DDGTECGGPEYETLWSFGSDCDVYDINAANTANMLCNEYGLDTISAGATIAAAMELYQRG
YIKDEEIAADGLSLKWGDAKSMVEWVKKMGRREGFGDKMADGSYRLCESYGAPEYAMTVK
KQELPAYDPRGAQGHGITYAVNNRGGCHIKGYMISPEILGYPEKLDRFALEGKPAYARVF
HDLTAVIDSLGLCIFTTFGLGAQDYVDMYNAVVGGELHDVNSIMMAGDRIWTLEKIFNLK
AGIDSSQDTLPKRLLEEPVPEGPSKGEVHRLDVLLPEYYSVRGWDSNGIPTEETLRKLGL
EEYIGKI
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtacggatataatggtaaggtgttaagaattaatctaagtaataaaacttatgtagta
gaagaattgaaaattgaccaagctaaaaaatttataggatcaagaggattaggcgtaaaa
accttatttgatgaagtagatccaaaaatagatccattatcacctgacaataaattcatt
atagcagcaggaccacttacaggtgcacctgttccaacaagtggaagatttatggtagtt
acaaagtcacctttaacaggagctattgccatttcaaactcaggtggaaagtggggagta
gagttaaaaatggctggatacgatatgataattgttgaaggcaaatcagataaggaagtt
tatgtgaatatagtagatgataaagtagaatttaaagatgcttctcatgtttggggaaaa
ctaacagaagaaaccacaaaaatgcttcaaaatgaaaatgatgcaaaggctaaggtttta
tgtataggaccagctggagaaaaactatcacttatggcagcagttatgaatgaggttgac
agaacagcaggccgcggcggcgttggagctgttatgggttcaaaaaatttaaaagctata
gtggtaaaaggaagtggaaaagtaaaattatttgatgaggaaaaagtaaaagcggtatca
cttgagaaatcaaatattttaagaaaagatccagtagcaggaagtggacttccaacatac
ggaacagctgtacttgttaatattataaatgaaaatggtatacacccagtaaaaaatttc
caagaatcttatacacctgaggcagataagattagtggagaaactatgactaaggattgc
ctagttagaaaaaatccttgctatagatgtccaattgcttgtggaagatgggtaaagctt
gatgatggaactgaatgtggaggaccagaatacgaaacattatggtcatttggatctgat
tgtgatgtatacgatataaatgctgcaaatacagcaaatatgttatgtaatgaatatgga
ttagatacaatatcagcaggagcaactattgcggctgctatggaactttatcaaagaggt
tacattaaggatgaagaaatagctgcagatggattatcacttaaatggggcgatgctaag
tccatggttgaatgggtaaagaaaatgggacgtagagaaggatttggagacaaaatggca
gatggttcatacagactttgtgaatcctatggtgcacctgagtatgctatgactgttaaa
aaacaagaacttccagcatatgatccaagaggagcacagggacatggtataacttatgct
gttaacaatagaggaggctgccatattaaaggatatatgataagccctgaaatacttgga
tatccagaaaaacttgatagatttgcattagaaggaaaaccagcatatgctagagtattc
catgatttaacagcagttatagattcccttggattatgtattttcacaacatttggtctt
ggtgcacaggattatgttgatatgtacaatgcagtagttggtggagaattgcatgatgta
aactctataatgatggccggagacagaatatggactttagaaaaaatatttaacttaaag
gcaggtatagatagttcacaggatactcttccaaagagattgcttgaggaaccagttcca
gaaggaccatcaaaaggagaggttcatagattagatgtacttcttcctgaatattactca
gtaagaggatgggattctaatggtattcctacagaagaaactttaagaaagcttggatta
gaagagtatattggaaaaatctaa

DBGET integrated database retrieval system