KEGG   Clostridium carboxidivorans: Ccar_13730
Entry
Ccar_13730        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_13730
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_13730
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cck02022]
    Ccar_13730
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_13730
Enzymes [BR:cck01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Ccar_13730
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Ccar_13730
Two-component system [BR:cck02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   Ccar_13730
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ccar_13730
SSDB
Motif
Pfam: CheB_methylest Response_reg MadL
Other DBs
NCBI-ProteinID: AKN31865
LinkDB
Position
complement(3140090..3141130)
AA seq 346 aa
MYKSKKVRVLVVDDSLIFRETVAKGIGKDIGIEVVGTASDPFDARDKIIEYEPDVITLDV
EMPKMNGIEFLKRLMPQYPLPVVVVSAVSSNVFDALNAGAVDFVTKPDGRSVNGLEGFIK
ELVTKIKIASVAKVAHWKKKSDERFSNNVISSNVSNKIIAIGSSTGGTEAVASILKMLPK
NIPPILVVQHMPPVFTKMYAERLNNSCPMEVREAKNGDRLYNGLALIAPGEYHMSLQKRG
AYYYVKCFKGEKVNGHCPAVDVLFESVAKEAGKNAIGIILTGMGYDGAKGLLSMKKRGAI
TIGQNEESCVVYGMPKVAYDIGAVQKQVSVENIAGTLGPYLNGSRT
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgtataagagtaaaaaggtaagagtactggtagtagatgactcacttatatttagggaa
actgttgctaaaggtattggcaaagacataggaatagaggttgttggtacagcttcagac
ccctttgatgcaagggacaagataattgaatatgaaccagatgttattaccttagatgta
gaaatgcctaaaatgaatggcatagaatttttaaaaaggttaatgcctcaatatccgctg
ccagttgtagtggttagcgcagtaagcagcaatgtatttgatgctttaaatgcaggagct
gtagattttgttaccaaaccagatggaagaagtgttaatggacttgaagggtttattaaa
gaattggttacaaaaataaaaatagcttctgtagcaaaagtagcacattggaagaaaaaa
agtgatgaaagattttcaaacaatgttataagcagtaatgtttcaaataaaattattgct
ataggttcatctacaggaggtacagaagctgtagctagtattttaaaaatgcttcctaaa
aatataccacctatacttgtagttcagcatatgcctccagtttttacaaagatgtatgct
gaaagacttaacaattcatgtcctatggaagtaagagaagctaaaaatggtgatagactt
tacaatggacttgcattaatagcacctggagaatatcatatgtctttgcaaaaaagagga
gcttattactatgtaaaatgttttaaaggtgaaaaggttaatggccattgtccagctgta
gatgtactttttgaatcagtggcaaaggaagcaggaaaaaatgctataggcattatactt
acaggcatgggatatgatggagcaaaaggattactttccatgaaaaaaaggggagctatt
actataggacaaaatgaagaatcctgtgtagtatatggaatgccaaaggtagcttatgat
ataggagctgtacaaaagcaggtttctgttgaaaatatagcaggtacactaggaccatat
ttaaatggaagtagaacttaa

KEGG   Clostridium carboxidivorans: Ccar_24955
Entry
Ccar_24955        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein CheY
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_24955
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_24955
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cck02022]
    Ccar_24955
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_24955
Enzymes [BR:cck01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Ccar_24955
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Ccar_24955
Two-component system [BR:cck02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   Ccar_24955
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ccar_24955
SSDB
Motif
Pfam: CheB_methylest Response_reg LSDAT_euk
Other DBs
NCBI-ProteinID: AKN33901
UniProt: C6PPK7
LinkDB
Position
5553959..5555035
AA seq 358 aa
MNKIKVLVVDDSALMRKFISDMINEQYDMETMDIARNGEDLLIKLSKGSIPDVITLDVEM
PKIDGITALKELKKKNINVPVIVLSSISKRGPELTMDCLAAGAFDFIPKPSGQISLDIDK
IKSELIEKIRLAFKKGLPKNKMINENIQVENKIETKVEYNNNFRSRSGKIEAVVIGASTG
GPKAIYTVITALPENLGVPVFVVQHMPVGFTKAFSERLDSNSKIHVVEASEGMNVKKDTV
YVAPGGFHMEVGADYKVHLNTEPPIWGVRPAVDKLFISASKVYGSQIVSAVLTGMGKDGA
DGTIEIKKRGGITIAEDKSTCTIYGMPKAAYETGMVDIVLPIDNVAHEIITSVSGNRR
NT seq 1077 nt   +upstreamnt  +downstreamnt
ttgaataagattaaagttttggttgtagatgattctgctcttatgagaaaatttatatca
gatatgataaatgaacaatatgacatggaaactatggatattgcaagaaatggagaagat
ttactaattaaattgtcaaaaggcagtatacctgatgttataactttagatgttgaaatg
cctaaaatagatggaattactgctttaaaggaattaaaaaagaagaatatcaatgtgcca
gtaatagttttaagcagtatttcaaaaagagggcctgagcttactatggactgtcttgca
gcaggagcatttgattttataccaaagccttccggacaaatatctcttgatatagataaa
attaaaagtgaactgattgaaaaaataagattggcatttaaaaaggggttgccaaaaaat
aaaatgattaatgaaaatatacaagtggaaaataaaattgagacaaaagtagaatataat
aataattttagaagcagatcaggtaaaattgaagcagtagttataggagcatctactgga
ggaccaaaggcaatatatacagtaattacagctttgcctgagaatttgggagttcctgta
tttgttgtacagcatatgcctgtgggatttactaaggctttttcggaaagacttgattcg
aatagtaaaatccatgttgtagaagcatcagaaggcatgaatgtaaaaaaagatacagta
tatgtagctccaggaggatttcatatggaggtaggagcagattataaagtacatttaaat
actgagcctcctatatggggagtacgtccagcagtagataaactatttatttctgcatca
aaagtatacggttctcaaattgtaagtgcagtacttacgggaatgggaaaagacggtgct
gatggaactatagaaataaaaaaaagggggggtataactatagctgaggacaagtcaact
tgtactatatatggtatgcctaaagcagcttatgaaacaggtatggtggatatagtatta
ccaatagataatgtagcacatgaaataataacatcagtatcaggaaataggaggtag

DBGET integrated database retrieval system