KEGG   Clostridium carboxidivorans: Ccar_13735
Entry
Ccar_13735        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein CheR
  KO
K00575  chemotaxis protein methyltransferase CheR [EC:2.1.1.80]
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_13735
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_13735
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_13735
Enzymes [BR:cck01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Ccar_13735
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ccar_13735
SSDB
Motif
Pfam: CheR CheR_N Methyltransf_12 Methyltransf_23 Methyltransf_11 zf-C2H2_2 Methyltransf_25
Other DBs
NCBI-ProteinID: AKN31866
UniProt: C6PXU5
LinkDB
Position
complement(3141137..3141949)
AA seq 270 aa
MIHIKQDEFKELTDYLKSNYGINLTKKKILIEGRLNNILIEKGFKNFRDYLNFLFNDMSK
NELTLLINKLTTNHTFFMREAAHFQYFKNEVLPYLESKVKDRDLRIWSAGCSSGEEPYTL
AMILQDYFQGNKAAWDKKVLATDISVNVIHTGERGIYSKESIENIPASWKLNYFNKIDND
NYQVSDKLRKEVIFRIFNLMDEVFPFKKKFHVIFCRNVMIYFDAKTKMELVNKFYKMTEP
GGYIFIGHSESISRDETDYRYIMPGVYRKG
NT seq 813 nt   +upstreamnt  +downstreamnt
atgattcatataaaacaggatgaatttaaagagttaacagactatttgaaaagtaattat
ggtataaatcttactaaaaagaaaattttaatagagggaagattaaacaatatattaata
gaaaaaggttttaaaaattttagggattatttgaattttttatttaatgatatgtcaaaa
aatgaattaactcttctcattaataagttaacaacaaatcacactttcttcatgagggag
gctgctcattttcaatatttcaaaaatgaagttttgccttatttggagagcaaagtaaaa
gatagagatttaagaatatggagtgctggatgttcctctggagaagaaccttatacctta
gctatgatactacaagattatttccaaggaaataaagcagcttgggacaaaaaagtttta
gctacagatatttctgtaaatgttattcatacaggagagagaggtatttattcaaaggaa
tccatagaaaatattccagctagttggaagttaaattattttaataaaattgataatgat
aattaccaagtttcagataaattgaggaaagaagttatttttagaatttttaatctcatg
gatgaagtatttccctttaagaaaaaatttcatgttatattttgcaggaatgtaatgatt
tattttgatgctaagacaaaaatggaattggtaaataaattctataagatgacagagcca
ggaggatatatttttataggacattcagaatctattagtagggacgaaactgattataga
tatataatgcctggagtttatcggaaaggatag

KEGG   Clostridium carboxidivorans: Ccar_24960
Entry
Ccar_24960        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein CheR
  KO
K00575  chemotaxis protein methyltransferase CheR [EC:2.1.1.80]
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_24960
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_24960
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_24960
Enzymes [BR:cck01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Ccar_24960
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ccar_24960
SSDB
Motif
Pfam: CheR CheR_N Methyltransf_12 Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 Tfb5
Other DBs
NCBI-ProteinID: AKN33902
UniProt: C6PPK6
LinkDB
Position
5555041..5555808
AA seq 255 aa
MDMGYFEKWVLKEFSINLSAYKSNQLHRRINSLMSRVGASSIEQYIEMLKKDPEQKQKFL
DFITINVSEFFRNPEIFEELKDKLKSELLKNSSSLKIWSAACSIGAEPYSIGMYLDEISP
TGRHKIIATDIDNTIIERAKRGEYVISEIKNVKKEYLDKYFTQQGDKYIMSPKIKNMVTF
KKHDLILENYDRDFDLIVCRNVVIYFNQDIKDKIYKKFSESLKKGGLLFVGATESIYNYR
DYGFEKASTFIYRKL
NT seq 768 nt   +upstreamnt  +downstreamnt
atggatatgggctattttgaaaaatgggtgcttaaagaatttagtataaacctatctgcc
tataaatcaaaccagcttcatagaagaataaatagtttaatgtcaagagtaggagcaagt
tccatagagcagtatatagaaatgctaaaaaaagatccagaacaaaaacaaaagtttcta
gactttataactataaatgtttcagagttttttagaaatcctgaaatatttgaagaactt
aaggacaagcttaagagtgaacttttaaagaatagcagctctttaaaaatatggagtgca
gcctgttctataggtgcagaaccttattctataggaatgtatttagatgaaatttcacct
actggtagacacaaaataatagcaacagatatagataataccataattgaaagagctaaa
agaggcgaatatgtaatttcagaaataaaaaatgtaaaaaaggaatatttggataaatat
tttacacaacaaggcgataaatatatcatgagccctaaaataaaaaatatggtaactttt
aaaaagcatgatttaatacttgaaaactatgatagagattttgatttgattgtatgcaga
aatgtggtaatatattttaatcaggatataaaggataaaatatataagaaattcagtgaa
tcgttaaaaaaaggtggactactatttgtaggagcaactgaaagtatatataattataga
gattatggatttgaaaaggcttctacatttatatacagaaagctgtaa

DBGET integrated database retrieval system