KEGG   Clostridium carboxidivorans: Ccar_14510
Entry
Ccar_14510        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein CheX
  KO
K03409  chemotaxis protein CheX
Organism
cck  Clostridium carboxidivorans
Pathway
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_14510
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_14510
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ccar_14510
SSDB
Motif
Pfam: CheX CheC
Other DBs
NCBI-ProteinID: AKN32009
LinkDB
Position
complement(3321989..3322450)
AA seq 153 aa
MDANHVNPFIEAFFNVMPQIGFTNIEKKGVILNKEIKSKGVIINLGIVGDAKGNVVYITD
IESGKKIASKMMMGMPVNELDDMAQSALSELTNMLTANASINLSEIGVNVNISTPTLLYG
EDIQIKMNVDKILCIQLTVDDIPIDVNIALQNL
NT seq 462 nt   +upstreamnt  +downstreamnt
atggatgcgaatcatgttaacccatttattgaagctttttttaatgtaatgcctcaaatt
ggatttactaacatagaaaaaaagggagttattttaaataaagaaattaaaagtaaagga
gttattataaatttaggtattgtaggagatgcaaaaggaaatgtagtttatataacagat
attgaaagtggtaaaaaaattgcatcgaaaatgatgatgggcatgccagtaaatgagtta
gatgatatggcacaaagtgctttatcagaactcaccaatatgttaactgctaatgctagt
attaatttgtctgaaataggagtgaatgtaaatatatctactccaacgttattatatgga
gaagatatacaaatcaagatgaatgtagataaaattttatgtattcaattaactgtagat
gacattcctatagatgtaaatattgcattacaaaatttataa

DBGET integrated database retrieval system