KEGG   Clostridium carboxidivorans: Ccar_21150
Entry
Ccar_21150        CDS       T03979                                 

Definition
(GenBank) flagellar motor protein MotA
  KO
K02556  chemotaxis protein MotA
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
cck02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_21150
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_21150
   02040 Flagellar assembly
    Ccar_21150
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cck02000]
    Ccar_21150
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_21150
Transporters [BR:cck02000]
 Other transporters
  Pores ion channels [TC:1]
   Ccar_21150
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Flagellar assembly proteins
   Stator
    Ccar_21150
SSDB
Motif
Pfam: MotA_ExbB
Other DBs
NCBI-ProteinID: AKN33197
UniProt: C6PZF0
LinkDB
Position
4695134..4695928
AA seq 264 aa
MDISVIIFVLVGFGSIIAGFVIEKGVIGSLFLLAPAVIVFGGTAGAVGLTFPGEILKRLP
KIIKVAITPKKIDLSALVAYFKDVSYKTRKNGLLSLEGEISADPNLDPFIKKGLQLVVDG
VDPQAVRSILELELESTSERHKKGAAIFAQAGGYAPTLGIIGTVMGLVHILADLSDPNTL
GPKIASGFLATLYGLSSANLLFLPLATRLKALDEKEFGEKSLIIEGILYIQEGINPNTIA
EKLKGFLSKEELKKFEGMDGKPEV
NT seq 795 nt   +upstreamnt  +downstreamnt
atggacatatctgttatcattttcgttttggttggatttggatctataatagcaggattt
gtaatagaaaaaggagtaataggttcacttttcctacttgcaccggctgtaatagtattt
ggtggaacagcaggagcagtcggcttaacgtttccaggagaaattttaaaaaggttacca
aaaataataaaggttgcaataactccaaaaaaaatagatttatcggctcttgtagcatat
tttaaagatgtatcttataagactagaaaaaatggattattaagccttgaaggagaaata
tctgcggatcctaatttagatccatttattaagaaaggacttcaattagtagtagatgga
gttgatccacaagctgttagaagtattttagagttagaattggaatctacatccgaaagg
cataaaaagggagcggctatttttgcacaagcaggtggatatgcgcctacacttggtatt
ataggtacagtaatgggactagttcacattttggctgatttgtctgacccaaacacctta
ggtcctaaaatagcatcaggattcttagctacattgtacggtctttcatctgcaaattta
ttgtttttaccattagcaactagattaaaagcactagatgaaaaagaatttggagaaaag
tcccttataatcgaaggtatattatatatacaagaaggaataaatcctaatactatagca
gaaaaattaaaaggatttttaagtaaagaagaacttaaaaaatttgaaggaatggatggt
aagccagaagtatga

DBGET integrated database retrieval system