KEGG   Clostridium carboxidivorans: Ccar_24945
Entry
Ccar_24945        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein CheW
  KO
K03408  purine-binding chemotaxis protein CheW
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_24945
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_24945
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_24945
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ccar_24945
SSDB
Motif
Pfam: CheW IFT81_CH DUF3236
Other DBs
NCBI-ProteinID: AKN33899
UniProt: C6PPK9
LinkDB
Position
5552951..5553397
AA seq 148 aa
MDSREAKILIFNINGEDYATDIMEVERILGYEQPTKLPDSPAFVEGVINYQGDVLPVISL
AKRFNLTKEEKKNDAKIIVSKQEDNKFGVIVDVVSEVRNINENEIETPPEIAVGISKRYI
KGLVKIQGRIIIFLNLASILTEDEKKLI
NT seq 447 nt   +upstreamnt  +downstreamnt
atggacagcagagaagctaaaatattaatatttaacataaatggagaagactatgctaca
gatattatggaagttgaaagaattttgggatatgagcagccaaccaaacttcctgattct
ccagcctttgtagaaggagtaataaattatcaaggcgatgtgttgccggtaatttcctta
gctaaaaggtttaatttgacaaaagaagaaaagaaaaatgatgctaaaataatagtatca
aaacaagaagataataaatttggagtgatagttgatgtagtatcagaagtgagaaacata
aatgaaaatgaaatagaaactccacctgaaatagcagtaggaatttcaaagagatatata
aaaggcttggtgaaaatacaaggaagaataattatatttctaaaccttgcaagcatactg
acagaagatgaaaaaaagcttatttaa

DBGET integrated database retrieval system