KEGG   Clostridium carboxidivorans: Ccar_24950
Entry
Ccar_24950        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein CheD
  KO
K03411  chemotaxis protein CheD [EC:3.5.1.44]
Organism
cck  Clostridium carboxidivorans
Pathway
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_24950
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_24950
Enzymes [BR:cck01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Ccar_24950
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ccar_24950
SSDB
Motif
Pfam: CheD
Other DBs
NCBI-ProteinID: AKN33900
LinkDB
Position
5553423..5553911
AA seq 162 aa
MEIKEIKVGIADLNTAFSPDRIITVGLGSCIGIAMYDNTKSLGGLAHIMLPDSTQFNNVT
NPLKFADLAVPILIEKLEKLGASRRNLKAKIAGGASMFNFSDKSMIMDIGNRNGIAVKNA
LKEYSIPILGEDIGGNKGRTMILDAGSGDVKIKTVGMGVREL
NT seq 489 nt   +upstreamnt  +downstreamnt
atggagataaaagagataaaagtaggaattgcagatttaaatacagctttttctcctgac
agaataataactgtgggattgggttcttgtataggaatagctatgtatgataatacaaaa
tcattaggtggacttgctcatataatgcttcccgatagtactcagtttaataatgtaaca
aatccgctgaaatttgctgatttagcagttcctatattaatagaaaaactggaaaagcta
ggagcatcaagaagaaatcttaaagctaaaatagctggaggagcttctatgtttaatttt
tcagataaaagcatgataatggatattggaaatagaaatggtatagcagtaaaaaatgct
ttaaaagaatactcaatacctatattaggagaagatatcggggggaataaaggaagaacc
atgatactggatgctggaagtggagatgtaaaaataaaaacagtaggaatgggagtaagg
gaactttaa

DBGET integrated database retrieval system