KEGG   Clostridium carboxidivorans: Ccar_24965
Entry
Ccar_24965        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein CheA
  KO
K03407  two-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_24965
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_24965
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cck01001]
    Ccar_24965
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cck02022]
    Ccar_24965
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_24965
Enzymes [BR:cck01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Ccar_24965
Protein kinases [BR:cck01001]
 Histidine kinases
  CheA family [OT]
   Ccar_24965
Two-component system [BR:cck02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   Ccar_24965
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ccar_24965
SSDB
Motif
Pfam: P2 CheW Hpt HATPase_c H-kinase_dim HATPase_c_3 DUF3597 FAD-SLDH
Other DBs
NCBI-ProteinID: AKN33903
UniProt: C6PPK5
LinkDB
Position
5555821..5557875
AA seq 684 aa
MDTSQYMSMFLEESMDNLQTLNESLLQLEQEPENIDKLNEIFRVAHTIKGMAATMGFNEM
AELTHKMEDVLSEFREGKLKVTQKVVTVLFKCLDTLEQMVNNISDGVEDEVSIVDIMNEL
ETIKEFADENPQMEGKAEEPVKEESAAGKKVNIELNEYDINVVKQAEDKGFKCYQIKIFL
SENTLLKSARAFLVFKNLEDFGEIIKSVPSTEDIENENFDFEIDLILLSTKEKDDISNSL
MNISEVDRVSVTDVDVKQEKAKRIEEKSKDDEVKAKAHEQKPAIQPKPAATNAPAKSAKA
PHKEAAHKKAHQSVRVDLERLDKFMNMVSELVIHRTRLEQISSNYKLNDLNETLEQVART
TSDLQDLVMKIRMLPVDTVFNRFPRMIRDLSVELDKEMELIIQGSETELDRTVIDEIGEP
LIHLLRNAADHGVEPKEERLAKGKSEVGKIKLIAYQEGTKAVIKVEDDGSGVPVDKVKAK
AERLGINTEGMSDNDIRNLIFMQGFSTNEQVTDISGRGVGMDVVKTKISALGGTVDLISE
KDKGSSFIIRLPLTLQIIQALLVKVGTETMAISLGYIDRVIDYSDDLVKMTNNKEVIIHN
GNVTPLVRLSNRLNLTKEDSAKNYIVIVNVGEKTVGLMVDGLFGQKEIVIKPLGKTLQGL
KEYIGATILGDGLVTLILDVAALV
NT seq 2055 nt   +upstreamnt  +downstreamnt
atggacacttcacaatatatgtctatgtttcttgaagaatctatggacaacttacaaaca
ttaaatgagtcactacttcaacttgaacaggagccagaaaatatagataaactaaatgaa
atatttagagtagctcatacaataaaaggtatggctgctactatgggctttaatgaaatg
gcagaactcactcacaaaatggaggatgtgctatcagaatttagagaaggaaagcttaag
gttactcaaaaagttgtaactgtgttatttaaatgtcttgacactttggagcaaatggtt
aacaatatatctgatggagttgaagatgaggtttcaattgttgatataatgaatgagctt
gaaacaattaaagaatttgcagatgaaaatccacagatggaaggtaaagctgaagagcct
gtaaaggaagagagtgcagcaggtaaaaaagttaatatagagctaaatgaatatgatatt
aatgtagtaaagcaagcagaggataaaggatttaaatgttatcagataaaaatatttcta
agtgagaatacacttttaaaatctgctagagctttccttgtatttaaaaatcttgaggat
tttggagaaataataaaatctgtaccaagtacagaagatatagaaaatgaaaattttgat
ttcgaaatagatctaatacttttatctactaaagaaaaagatgatataagtaatagttta
atgaatatatcagaggtagatagggttagcgttactgatgtagatgtaaaacaggaaaaa
gctaagagaatagaggaaaaatctaaagatgatgaggtaaaggctaaagctcatgagcaa
aaacctgcaatacagccaaagccagcagcaacaaatgcaccagcaaagagtgcaaaagca
cctcataaagaagcagcacataaaaaggctcatcaatctgtaagagtagatcttgaaaga
ttggataagtttatgaatatggtttcagaactcgttattcatagaacaagattagagcaa
ataagtagtaattataaattgaatgatttaaatgaaactttagagcaggtagctagaact
acatcagatcttcaagatttagttatgaagatcagaatgcttccagtggatactgtattt
aatagattcccaagaatgataagagatctttctgtagaattagataaggaaatggaactt
atcatacaaggttcagaaactgaattagatagaactgtaatagatgaaataggagaacct
ttaattcatttattaagaaacgcagcagatcatggtgttgaaccaaaggaagagagatta
gctaaaggtaaaagtgaagttggaaaaataaaacttatagcttatcaagaaggaactaaa
gctgtaataaaggtagaagacgatgggtctggagtacctgtagataaagtaaaagctaaa
gcagaaagattaggaataaatacagaaggaatgtctgataatgatataagaaatttaata
tttatgcagggctttagtactaatgaacaagttacggatatctctggtagaggagttggt
atggatgtagtaaaaactaagatatcggctcttggtggtaccgtagacttaataagtgaa
aaagataaaggatcatcctttataataaggcttccattaactcttcaaataattcaagct
ttacttgttaaggttggaactgaaactatggctatatcattaggatatatagatagagtt
atagattatagtgatgatttagttaaaatgactaataataaagaagttataatacacaat
ggcaatgtaacacctcttgtaagattgagtaatagacttaatttaactaaagaggatagt
gctaaaaactatatagtaatagtaaatgttggagaaaaaactgtaggactcatggtagat
ggattgtttggacaaaaggaaatagttataaaacctcttggaaaaacacttcaaggacta
aaagaatatataggagcaacaatacttggagacgggttagtaacattaatactagacgtt
gctgctttagtgtag

DBGET integrated database retrieval system