KEGG   Clostridium carboxidivorans: Ccar_24970
Entry
Ccar_24970        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein CheY
  KO
K03410  chemotaxis protein CheC
Organism
cck  Clostridium carboxidivorans
Pathway
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_24970
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_24970
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ccar_24970
SSDB
Motif
Pfam: CheC CheX FliM
Other DBs
NCBI-ProteinID: AKN33904
UniProt: C6PPK4
LinkDB
Position
5557892..5558494
AA seq 200 aa
MSYQDMTPLQLDALREVGNIGTGNAATALSQLINRKVDMTVPDINIVPFDDIFSSIGGDE
IVVGVIVRVLGEAPGNILFVFEKDTALNLVETLTGEKEEYLSEMGNSVICEIGNIISSSY
MNAISRFTGLAIMPSVPAVSYDMLGAILSTTFIESGQFDDYVLDIETMFIQGESEIEISG
HFYYVPMPGSLEKMLSALGV
NT seq 603 nt   +upstreamnt  +downstreamnt
atgagctatcaagacatgacgccattacagcttgatgcactaagggaagtaggaaatata
ggtacagggaatgctgctacagcactgtcacaacttataaatagaaaagtggatatgaca
gttcctgacataaatattgtaccttttgatgatattttttcaagtataggtggagacgaa
atagttgtaggagttatagtgagggttttaggtgaagcaccgggtaatatattatttgta
tttgaaaaagatactgcactaaatttggtagaaactttaaccggtgaaaaagaagaatat
ttaagtgaaatgggtaattctgtaatatgtgaaataggtaatataatatctagttcgtat
atgaatgctatatcaagattcactggactagctataatgccttcagttccagcagtaagt
tatgatatgctaggagcaatactttctacaacatttatagaatcaggacagtttgatgat
tatgtacttgatatagagactatgtttatccagggagaatctgaaatagaaataagtgga
cacttttattatgtaccaatgcctggttcacttgagaaaatgttaagtgcattaggagtt
taa

DBGET integrated database retrieval system