KEGG   Clostridium carboxidivorans: Ccar_24975
Entry
Ccar_24975        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein CheY
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_24975
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_24975
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cck02022]
    Ccar_24975
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_24975
Two-component system [BR:cck02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   Ccar_24975
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ccar_24975
SSDB
Motif
Pfam: Response_reg B12-binding
Other DBs
NCBI-ProteinID: AKN33905
UniProt: C6PPK3
LinkDB
Position
5558533..5558892
AA seq 119 aa
MSKVLIVDDAAFMRMMIKDILEKNGFEVIGEGNNGLKAVELYKKERPDVVTMDITMPDMD
GIEAVKAIKAFDPSAKIIMCSAMGQQTMVMDAIKAGAKDFIVKPFQPDRVLEAIKKVIG
NT seq 360 nt   +upstreamnt  +downstreamnt
atgtcaaaagtattaattgttgatgatgctgcttttatgagaatgatgataaaggacata
ttagaaaaaaatgggtttgaagtaataggagaaggaaataacggtctaaaagctgtagaa
ttgtataaaaaggaaagaccagatgtagtaactatggatataactatgccggatatggat
ggaatagaagctgtaaaagcaataaaggcattcgatccatcagctaaaataataatgtgt
tcagctatgggacagcagacaatggttatggatgcaataaaagcaggagcaaaggatttt
attgtaaaaccattccaaccagatagagtactagaagctattaaaaaagtaataggatag

DBGET integrated database retrieval system