KEGG   Clostridium carboxidivorans: Ccar_24980
Entry
Ccar_24980        CDS       T03979                                 

Definition
(GenBank) chemotaxis protein CheW
  KO
K03408  purine-binding chemotaxis protein CheW
Organism
cck  Clostridium carboxidivorans
Pathway
cck02020  Two-component system
cck02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cck00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ccar_24980
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_24980
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Ccar_24980
SSDB
Motif
Pfam: CheW DUF2316
Other DBs
NCBI-ProteinID: AKN34250
LinkDB
Position
5559179..5559577
AA seq 132 aa
MQVVVFKLNNEQFAVETAKVQSINDAMEITKVPKAPGHIKGLINLRGNVISLLDINLLLD
VSKSEEKQNNIIILEMEDELVGITVDQVDEVLEVEEGIIEKINDGKKAYIEGVINFKDRI
VTLIDIDKLLSN
NT seq 399 nt   +upstreamnt  +downstreamnt
atgcaggttgttgtatttaaattaaataacgaacagtttgcagtagaaactgcaaaggtt
caaagcataaatgatgctatggaaattacaaaagttccaaaggcaccaggacatataaaa
ggactcataaatttaagaggtaatgtgatatcacttttagatataaatcttttattagat
gtatcaaaatctgaagagaaacaaaataatataattatcttagaaatggaagatgaatta
gtaggaataacagttgatcaagtggatgaagttttagaagtggaagaaggaataatagaa
aaaataaacgatggtaaaaaagcttatatcgaaggagttataaattttaaagatagaatt
gtaacacttatagatatagataaacttctttcaaattag

DBGET integrated database retrieval system