KEGG   Clostridium carboxidivorans: Ccar_24985
Entry
Ccar_24985        CDS       T03979                                 

Definition
(GenBank) flagellar motor switch protein FliM
  KO
K02416  flagellar motor switch protein FliM
Organism
cck  Clostridium carboxidivorans
Pathway
cck02030  Bacterial chemotaxis
cck02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:cck00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_24985
   02040 Flagellar assembly
    Ccar_24985
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_24985
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Flagellar assembly proteins
   C ring
    Ccar_24985
SSDB
Motif
Pfam: FliM FliMN_C Glyco_hydro_4C
Other DBs
NCBI-ProteinID: AKN33906
UniProt: C6PPK1
LinkDB
Position
5559608..5560606
AA seq 332 aa
MADVLSQSEIDALLAALSAGELTPDEVPKEEEKQKVKPYDFRSPQKFSKDHIRTLELIHD
NYARIISNYLTAQVRSNVKVKIESVQQITYEEFIHSVPNPTILTVFKMPPLSGSVLFETN
PQFSFEIIDVLLGGKGTGKYKAREFTDIDKNIMMVINTGLISNLKLAWDDVLEVNTEIEG
LETNPALNQTLAPNEAVALITFSVEMGKSSTFINICIPYLSIEKVLDKLVVQYWFQDTND
EAILEESRVKLRQRLNIVNMNLTAVLGTTNITVDDFLRLGVGDVLTLNDKANTPIKLMVE
DKPYCYGKPGVLGKNMGVQILDIIDKDVENYE
NT seq 999 nt   +upstreamnt  +downstreamnt
atggcagatgtattatcgcagagcgagatagatgctcttttagctgccttgtctgctgga
gaattaactccagatgaagtaccaaaagaagaagaaaaacaaaaggttaagccttatgat
tttagaagtcctcaaaaattttcaaaggaccatataaggacacttgaacttattcatgat
aactatgctagaataatttcaaattatttaactgcgcaggtaagaagtaatgtaaaagta
aagatagagtctgtacagcaaataacttatgaagagtttattcactctgtgccaaatccc
acaatccttactgtatttaaaatgccacctttaagtggatctgtattatttgaaacaaat
ccacaattttcttttgaaataatagatgtgcttttaggtggaaaaggaacgggcaaatat
aaagcaagagaatttacagacattgataaaaacattatgatggtcataaatacaggcctt
atatctaatttgaaattagcctgggatgatgtgcttgaagttaatactgaaatagaagga
ttagaaactaatccggcattaaatcagactttagcgccaaatgaagcagtagccttaata
actttttctgtagaaatgggcaaaagcagcacctttattaacatatgtataccttattta
agtatagaaaaagtattggataagcttgtagtacaatattggttccaggacactaatgat
gaagcaatattagaggaatctagagtgaaattaagacaaagattgaatatagtaaatatg
aatcttactgcagtgttaggtactacaaatattactgtagatgatttcttaagattaggt
gtaggtgatgtgttaacattgaatgataaagcaaatacgcctattaaattaatggtggaa
gataagccatattgctatggaaaaccaggagtgttggggaaaaatatgggggttcagata
ctagatattatagataaggatgtggaaaattatgagtaa

DBGET integrated database retrieval system