KEGG   Clostridium carboxidivorans: Ccar_24990
Entry
Ccar_24990        CDS       T03979                                 

Definition
(GenBank) flagellar motor switch protein
  KO
K02417  flagellar motor switch protein FliN
Organism
cck  Clostridium carboxidivorans
Pathway
cck02030  Bacterial chemotaxis
cck02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:cck00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_24990
   02040 Flagellar assembly
    Ccar_24990
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cck02044]
    Ccar_24990
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_24990
Secretion system [BR:cck02044]
 Type III secretion system
  Flagellar export apparatus
   Ccar_24990
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Flagellar assembly proteins
   C ring
    Ccar_24990
SSDB
Motif
Pfam: FliMN_C CheC CheX TFIIA
Other DBs
NCBI-ProteinID: AKN33907
UniProt: C6PPK0
LinkDB
Position
5560599..5561819
AA seq 406 aa
MSNGFLSQEEIDALLNGGGEDTPPEPSEETKTSEETPETSNESELPALTDIERDLLGEIG
NISMGSASTALSTIINQQVNITTPIVTITRLKDLKDQFEVPNVALEVKYVSGIVGENLLV
MKITDAAVIANLMMGGDGNVEGDPKELSEIELSAVSEAMNQMIGSAATSMATMFMREVNI
SPPVSTIWNDLKSPVAKGISEDEPIIKVSFSLAIGDLVDSTIMQILPIATAKKIVSIMMG
QESPEGEAPAQPEPQAAPQQQEPVPQPVTPQQQVQQSQPQAQYQAPPQQVIYEKPIEAPR
VEVKQAAFQPLAPVGSSAEMPKNIDLILDVPLDISVVLGRTKKNIKDILNLGTGSLIELD
KLAEEPVEILVNGKRVAYGEVVVVDENFGVRITSIISSEERIKSLK
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgagtaatgggtttctttcacaagaagaaatagatgcacttttaaatgggggaggcgaa
gacacaccacctgaaccatcggaagaaacaaaaacttcagaggaaacaccagagacatca
aatgaatcagaattacctgcgttaactgatatagaaagagacttattaggggaaataggt
aatatatctatgggttctgcatccacagcgctttctacaataattaatcaacaggtaaat
ataactaccccaatagttactataactagattgaaggatttaaaagatcaatttgaagtt
ccaaatgttgcattggaagttaagtatgtaagtggtatagttggagaaaatcttcttgtt
atgaaaattacagatgcagctgtaattgcaaatctcatgatgggaggagatggaaatgta
gaaggagatcctaaggaattatctgaaatagaacttagtgctgtatcagaggctatgaac
caaatgataggttctgcagcaacttctatggctaccatgtttatgagagaagtaaatata
tccccacctgtatccacaatatggaatgatttgaaatctcctgtggctaaaggtatatca
gaggatgagccaataattaaagtatccttctctttagcaataggtgatttagtagatagt
actataatgcaaatattgccgatagctacagcaaaaaagatagtatcaataatgatgggg
caggaatctcctgaaggagaagcaccagctcagccagagccacaagcagctccacaacag
caagaaccagtgccacagccagtgacacctcaacagcaagttcaacaaagtcaaccacaa
gcgcaatatcaggcaccaccacagcaagttatatatgaaaaacctatagaggcaccaagg
gttgaggttaagcaagcagcattccagcctttagctccagtaggttcaagtgcagaaatg
cctaagaacatagatttaatattagatgtacctttagatatatctgtagtactgggaaga
acgaaaaagaatataaaggatatattaaatttaggaacaggatctctaatagaattagat
aaattagcagaagaaccagtagaaatacttgtaaatggaaaaagagtagcttatggtgaa
gtagttgtggtagatgaaaactttggtgtaagaattacaagcattataagtagtgaagaa
agaattaaatctttaaaataa

DBGET integrated database retrieval system