KEGG   Clostridium carboxidivorans: Ccar_25215
Entry
Ccar_25215        CDS       T03979                                 

Definition
(GenBank) flagellar motor switch protein FliG
  KO
K02410  flagellar motor switch protein FliG
Organism
cck  Clostridium carboxidivorans
Pathway
cck02030  Bacterial chemotaxis
cck02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:cck00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Ccar_25215
   02040 Flagellar assembly
    Ccar_25215
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:cck02035]
    Ccar_25215
Bacterial motility proteins [BR:cck02035]
 Flagellar system
  Flagellar assembly proteins
   C ring
    Ccar_25215
SSDB
Motif
Pfam: FliG_C FliG_N FliG_M MgtE_N
Other DBs
NCBI-ProteinID: AKN33950
UniProt: C6PPF2
LinkDB
Position
5607819..5608835
AA seq 338 aa
MARENEKLTGVQKAAILFITLGPEASAGIIKKLPESEIQKITYEIANIASVKSEQKQEIL
AEFIEMNKAKDYLTEGGMEYAKNLLAKALGSQRAMEILDKVTEATQQFRPFAIARKADAH
QLLNIITNEHPQTIALILCYLQSDKSGQILSALPEDVQAEVAYRIATMSNTSPVVVKEIE
KVLDGKLSSVVKSDMKVIGGVQTIVDILNQVDRTTEKNITEGLEKEDAELAEKVKESMFV
FEDIITLDDVSIQRVLREVENKELGLALKGCSEEVANSIFRNQSKRAAAALKEDIEFLGP
VRLMDVEKAQQRIVSIIRRLDEAGEIVISRGGEDAIIV
NT seq 1017 nt   +upstreamnt  +downstreamnt
ttggcaagagaaaatgaaaaattaacaggtgttcaaaaagcagccatattattcataact
cttggtccagaggcttctgcaggaataattaagaaattgccagagtcggaaatacagaaa
ataacctatgaaatagctaatatagcatcagttaagtccgaacagaaacaggaaatactt
gcagagtttatagaaatgaataaggctaaagattacttaactgaaggtggaatggaatat
gctaaaaaccttttagccaaagcattaggtagtcaaagagctatggaaatattggacaag
gttacagaagctacacagcaatttaggccttttgcaatagctagaaaggcagatgctcat
caacttttaaatataataactaatgagcatccacaaactattgctcttatactatgttat
cttcaatcagataaatcaggacaaatattatctgcattaccagaagatgtgcaggcagaa
gtagcttacagaatagctacaatgagtaatacatctccagtagtggtaaaggaaattgaa
aaagttttggatggtaagttatcttcagtagttaaatctgatatgaaggtaattggtgga
gttcaaactatagtagatatacttaaccaagttgatagaactacagagaaaaatattact
gaaggtcttgaaaaagaagatgctgaattggcagaaaaagttaaagagtctatgtttgta
tttgaagacattattactcttgatgatgtttctatccaaagagttcttagagaagttgaa
aacaaagaacttggattggcacttaaaggctgttcagaagaagttgcaaattctattttt
agaaatcaatctaagagagcagctgctgctttaaaggaagatatagaattccttggacca
gtaagacttatggatgtggaaaaagctcaacagagaattgtaagcattataagaagatta
gatgaagctggagagatagtaatatcaagaggtggagaagatgcaatcatcgtatag

DBGET integrated database retrieval system