KEGG   Hungateiclostridium clariflavum: Clocl_0661Help
Entry
Clocl_0661        CDS       T01661                                 

Definition
(GenBank) translation elongation factor TU
  KO
K02358  elongation factor Tu
Organism
ccl  Hungateiclostridium clariflavum
Brite
KEGG Orthology (KO) [BR:ccl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ccl03012]
    Clocl_0661
   03029 Mitochondrial biogenesis [BR:ccl03029]
    Clocl_0661
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccl04147]
    Clocl_0661
Translation factors [BR:ccl03012]
 Eukaryotic Type
  Elongation factors
   Clocl_0661
 Prokaryotic Type
   Clocl_0661
Mitochondrial biogenesis [BR:ccl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Clocl_0661
Exosome [BR:ccl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Clocl_0661
  Exosomal proteins of breast cancer cells
   Clocl_0661
  Exosomal proteins of colorectal cancer cells
   Clocl_0661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AEV67368
UniProt: G8LUM8
LinkDB All DBs
Position
775296..776498
Genome map
AA seq 400 aa AA seqDB search
MAKAKFERSKPHVNIGTIGHVDHGKTSLTAAITKVLSYQGKAQYSAYDQIDKAPEEKERG
ITISTSHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVFLNKCDMVDDEELIELVEMEVRELLSSYEFPGDEIPIIRGSALKALE
CTATTPDAPEYAPILELMNKVDEYIPTPQRAVDKPFLMPVEDVFSITGRGTVATGRVERG
QLKLSDEVEIVGLMDAPKKTVVTGIEMFRKLLDQAEAGDNIGALLRGIQRDEIERGQVLA
KPGSIKPHTYFEAQVYVLTKEEGGRHTPFFNNYRPQFYFRTTDVTGVVELPEGTEMVMPG
DHVTMKVKLITPIAMDEGLKFAIREGGRTVGSGNVNKIIE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagctaaatttgaaagaagtaaaccccacgttaatatcggaactataggtcac
gttgaccatggtaagacttcattgactgcagctataacaaaagtattaagctatcaagga
aaggcacaatattctgcatatgaccagattgacaaggctcctgaagaaaaagaaagaggt
atcacaatttcaacatctcacgttgaatatgaaactgaaactagacactatgcacacgtt
gactgcccaggtcacgctgactacgttaagaacatgatcactggtgcagctcagatggac
ggtgctatccttgttgtttcagctgctgatggtccaatgcctcagacaagagaacacatt
cttttggctcgtcaggttggcgttccatacatagttgttttcttaaacaagtgtgatatg
gttgacgacgaagagcttattgaattagttgaaatggaagttagagaattgttaagctcc
tacgaattcccaggagatgaaattccaataattagaggatcagctcttaaagctcttgag
tgcacagctacaacacctgatgctcctgaatatgcaccaatcttggagttgatgaataaa
gttgatgaatacattccaactcctcaaagagcagttgacaaaccattccttatgcctgta
gaagacgtattctctatcacaggtcgtggaacagttgctacaggtagggttgaaagaggt
caattaaaactttccgacgaagttgaaatcgttggtttgatggacgctcctaagaagact
gttgtaaccggtatagaaatgttcagaaagcttcttgatcaagctgaagccggtgacaat
atcggtgctctcttaagaggtattcagagagacgaaattgaaagaggacaagttcttgca
aaacctggttcaattaaacctcatacttatttcgaagctcaagtttacgtattgacaaaa
gaagaaggtggaagacatactccattcttcaacaattacagacctcagttctacttcaga
actactgacgttacaggagttgttgaactccctgaaggtactgaaatggttatgcctggt
gaccacgtaacaatgaaagttaaattgatcactccgatagctatggacgaaggattgaag
ttcgctattcgtgagggtggaagaactgttggatcaggtaacgttaacaagattatagaa
taa

DBGET integrated database retrieval system