KEGG   Clostridium clariflavum: Clocl_3100Help
Entry
Clocl_3100        CDS       T01661                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
ccl  Clostridium clariflavum
Pathway
ccl00500  Starch and sucrose metabolism
ccl01100  Metabolic pathways
ccl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Clocl_3100
Enzymes [BR:ccl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Clocl_3100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase Mak10
Motif
Other DBs
NCBI-ProteinID: AEV69627
UniProt: G8LV50
LinkDB All DBs
Position
3630627..3633194
Genome map
AA seq 855 aa AA seqDB search
MYLFGKINVTAVIPEELSRLKDIAYNLWWSWNSDAIDLYREIDLALWEKVEKNPVRFLKE
VSQKKLEAKVNDPDYMERYTKVVQKFDSYMQETDTWFSRNYPDKKDHMIAYFSAEYGLNE
VLPIYSGGLGVLSGDHCKSASDLGIPFTAIGLFYKQGYFSQHINSEGWQETIYNDLNISN
LPVKPALNQNGEQAVISVELPGRVVYARVWQVQIGRVNLYLMDTDFEQNSPHDRMLTARL
YGGNQETRIQQEIFLGIGGARVLDALNIKATVYHMNEGHSAFLGLELIRKLVQDKKLPFN
HAKEVVSSSLIFTTHTPVPAGNDVFPLEMIDRYFGNYWPSLGINRHEFLDLGLKIGDHQN
FNMTVLALTLAGQKNGVSELHGAVSRNIFKNVWPSIPEDEVPIGHITNGIHTLTWLSPSI
KFLYDKYFEQNWHENLHDPKVWEAVDKIPDEELWKTHCVLKTKMIGYIREKLKQQRAANG
ESIERIKEVDTLLDSNALTIGFARRFATYKRANLIFRNLARIQKLLNDPEKPMQIIFAGK
AHPADGPAHEIIKHINDIAKQEGFVGKVILVENYNMTLARNMVQGVDIWLNNPRRPLEAS
GTSGQKVCINGIINFSVLDGWWCEGYNGKNGWCIGDDTFYDNEHYQDNADSESIYNTLEK
EILPLFFDRNEKGIPEKWVAIMKESIKSNAALFSTHRMVQEYTTKYYLTSMDRVDKDLAS
NYQFSVNLSNWKTHVEKLWPQVQILADKTANQLKEMNSSSGENIKISATVYLGGLDPSSV
KVQIYYGGIGKDNLIESPEIIDMHLDGKTDEGTYIYSANIKLFEGGEYGYTFRVIPYHPD
LINPFDLGLIRWIVQ
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atgtatttatttggaaaaataaacgtaacagcagtaataccagaggaattgtcaagatta
aaggacattgcctataatctatggtggtcctggaattccgatgcaattgacttatatagg
gaaatcgaccttgctttatgggaaaaagtcgaaaaaaatcctgtaaggtttttgaaagaa
gtaagccagaaaaaactggaagcaaaagtaaatgaccccgattacatggaaaggtatacc
aaagttgtacaaaaatttgactcatatatgcaagaaacggatacttggttttccagaaat
tatccagacaaaaaagaccatatgattgcatatttctctgccgagtatggccttaatgaa
gttctgccaatatattcgggcggcttaggtgttctttccggagaccattgcaaatcggca
agcgatcttggaataccttttactgccattggactcttctataaacaggggtatttcagt
cagcatataaacagcgaaggttggcaggaaaccatatataatgaccttaatatttccaat
cttccggtaaaacccgcccttaaccagaacggagaacaggcagtaataagcgtggaactt
cccggtagagttgtgtatgcaagggtttggcaagtacagattggacgtgtcaatttatac
ttaatggacactgattttgaacaaaacagtccccatgacaggatgcttactgcaagactg
tacggcggaaaccaggaaacaagaatacaacaggaaattttccttggtataggcggggca
agagtgcttgatgctttaaacattaaagctactgtatatcatatgaatgaaggacactcc
gcatttttaggcctggaattgataagaaaacttgtacaggacaaaaaattgccctttaac
catgccaaagaagttgtttcctcttcattgatatttacaacccatacaccggtccctgca
ggaaatgacgttttccctcttgaaatgatagaccgttactttggcaattactggccgtca
ttgggaataaaccgccatgaatttcttgatctcggcttgaagattggagatcatcagaac
tttaacatgactgttcttgcattgactcttgcaggccagaaaaacggagttagtgaactt
cacggtgcagtatcgaggaacatattcaaaaatgtatggcccagcatccctgaagatgaa
gttccaatcggtcacattaccaacggtatccatacccttacttggttatctccaagtatc
aagttcttatatgacaagtattttgaacaaaattggcatgaaaacttacacgatccgaaa
gtatgggaagctgtggataaaattcccgatgaggaactttggaaaactcactgtgttttg
aagactaaaatgattggatatataagggaaaaactaaaacagcaacgggctgcaaacggc
gaatctattgaaagaatcaaggaagtcgatacattgcttgactcaaacgctcttacaata
ggctttgcaagaaggtttgcaacctataaaagagccaatctgatatttagaaatttagca
agaattcaaaaattgcttaatgacccggaaaaacccatgcagataatttttgccggtaaa
gctcatcctgccgacggaccggcccatgaaattatcaagcatattaatgatattgcaaag
caggaaggatttgtgggaaaagtcatcctggttgaaaattataatatgactcttgccaga
aatatggtacaaggtgtggatatctggctcaacaaccccagaagaccacttgaagccagc
ggtacaagcggtcagaaagtttgtataaacggtattataaacttcagcgtactggacggc
tggtggtgtgaaggttacaacggcaaaaacggttggtgcatcggcgatgacactttctat
gataatgaacactatcaggacaatgctgacagcgaatctatttacaatacccttgaaaaa
gaaattctaccccttttctttgatcgcaatgaaaagggaattccagaaaaatgggtagca
attatgaaagagtcgataaaatccaatgcagcattattcagtacccatagaatggttcag
gaatacaccaccaaatactatttgacttccatggacagggtcgacaaagacttggccagc
aactatcaattctctgtaaatctgtccaattggaagacacatgtggaaaaactctggcct
caggtgcagatattagctgataaaacagccaatcaattgaaggagatgaactcttcatcc
ggtgaaaacatcaaaataagtgccaccgtttatttgggcggtctggatccttcaagtgtc
aaagtgcaaatatattatggcggaataggcaaagataatttaattgaaagtccggaaata
attgatatgcatctggatggaaagaccgatgaaggtacttacatctattcggcaaatatc
aaattgtttgaaggcggagaatacggttatacctttagagtaatcccttatcatccggat
ctgataaatccgtttgacttaggattaatccgttggatagttcaataa

DBGET integrated database retrieval system