KEGG   Capnocytophaga canimorsus: Ccan_02880Help
Entry
Ccan_02880        CDS       T01582                                 

Definition
(GenBank) Alpha-ketoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ccm  Capnocytophaga canimorsus
Pathway
ccm00020  Citrate cycle (TCA cycle)
ccm00310  Lysine degradation
ccm00380  Tryptophan metabolism
ccm01100  Metabolic pathways
ccm01110  Biosynthesis of secondary metabolites
ccm01120  Microbial metabolism in diverse environments
ccm01130  Biosynthesis of antibiotics
ccm01200  Carbon metabolism
Module
ccm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ccm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ccm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ccan_02880
  09105 Amino acid metabolism
   00310 Lysine degradation
    Ccan_02880
   00380 Tryptophan metabolism
    Ccan_02880
Enzymes [BR:ccm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Ccan_02880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AEK22410
UniProt: F9YR52
LinkDB All DBs
Position
complement(312729..315524)
Genome map
AA seq 931 aa AA seqDB search
MDKYSFLNAASTAYFGELYERYLENPDAIEPSWRAFFQGFDFAQENYGYEQAVETVVQQI
SNDTEGSFVCEKLQKEFKVINLINGYRTYGHLFTKTNPIRERELHKPDLSIENYGLTPTD
LDTVFDSAKEIGLQPTSLRNIIEQLNKIFCASVGIEYTYIREPKTITWIQERLQKNANQP
NFNKNEKIQILNKLNEAVSFENFLHTKYVGQKRFSLEGGEAIIPALDFVINTAAEQGVEH
FVMGMAHRGRLNVLANILKKSPQDIFSEFDGKDYEVENFDGDVKYHLGLTSERVTSSGKK
INLNLAPNPSHLETVSTVIEGITRAKQDRYFPNDISKVLPVAIHGDAAIAGQGLVYEVIQ
MAKLKGFKTGGTIHIVINNQVGFTTNNTDARSGTYCTDIAKVTNSPVLHVNSDDTEAVVH
ALLFALDYRMTFGTDIFIDLLGYRKYGHNEGDEPRFTQPKLYKIIAKHDNPRTIYAKKLS
EQGIIEEGYVGNIEAEYKAKLEVDLEASRQETLTVIKPFMQDEWQGFEIASQEKMLEKVN
TKFNADDLSEIAQIITELPSDKGFINKIKKIISDRKDGFFNNHIVDWGMAEHLAFATLLT
EGFDVRLTGQDVQRGTFSHRHAVVKSEDLEEEVVMLHQLKNKEKFSKGNFYVYNSLLSEY
GVLGFEYGYALASPNTLTIWEAQFGDFSNGAQIMIDQYVCCGEDKWKNQNGVVLLLPHGY
EGQGSEHSSARIERYLQLCANKNMYVANCTTPANIFHLLRRQMKTDFRKPLVVFSPKSLL
RHPEVVSPINDLANGQFQEVIDDPNIDPKKVKTLVFCSGKFYYDLKAEREKLGRDDVALI
RIEQLFPLPTQQIKAVIAKYKKANDYVWAQEEPKNMGAYGYMLMYFDWIKWRLACVRAAS
APAPGSYTRDRKYHQQAINAVFDSNIDHRKN
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atggataaatattcttttttgaatgccgcaagtacggcttattttggagaactatacgaa
agatatcttgaaaatccagatgccattgaacctagctggagggctttcttccaaggtttt
gactttgcacaggaaaattacggatacgaacaagccgttgaaacggtagtccagcaaatc
tcaaacgacaccgaaggcagtttcgtttgtgaaaaactacaaaaagagtttaaagtaatc
aaccttatcaacggatacagaacttacggacatctgtttaccaaaaccaacccaatacgt
gagcgagaacttcataaacctgatttgagtatcgaaaattacgggcttacccctaccgat
ttagataccgtttttgattccgctaaggaaattgggttacagcctacttcacttcgtaac
atcattgaacaactcaataagatattttgtgcctctgtgggcatcgaatatacctacatt
cgtgagcccaaaaccataacgtggattcaagaacgtttgcaaaaaaatgcaaatcagcct
aatttcaataaaaacgaaaaaatacaaatccttaataaactcaatgaagccgtttctttt
gaaaactttttacacactaaatatgtagggcaaaaacgtttttctttagaaggtggcgag
gctattattccagctttggattttgttatcaatactgctgcggaacaaggtgttgaacat
tttgtaatgggaatggcgcatcgtggtcgcttaaatgtacttgccaatattttaaaaaaa
tcacctcaagatattttttcagaatttgacggaaaagattacgaagttgaaaatttcgat
ggagatgttaaatatcatttaggattaacttccgaaagggttacctcttcgggcaaaaaa
ataaatctaaatttagctccaaacccttcgcatttagagaccgttagtactgttatcgaa
ggaattacacgtgctaaacaagaccgctatttccccaatgacatttcaaaagtattaccc
gttgccatacacggcgatgctgccattgctgggcaaggtttggtttacgaggtgattcaa
atggcgaaattaaaaggctttaaaactggaggaaccattcatatcgtaatcaacaatcaa
gttggatttaccaccaataataccgatgcgcgttcgggaacctactgcaccgatatcgcc
aaagtgaccaattcgcctgtacttcacgtaaactcggacgatacagaagccgttgtacac
gctttactttttgctctggattaccgaatgactttcggtaccgatatctttattgaccta
ttgggctatcgaaaatacggacacaatgagggcgatgaacctcgatttacacaacctaag
ttgtataaaatcatcgcaaaacacgataatcctagaaccatttacgcaaaaaaattatcg
gaacaaggcattattgaagagggttacgttggcaacattgaagccgagtataaggcaaaa
cttgaagtggacttagaagcatcacgccaagaaacgctaacggtgataaagccctttatg
caagatgagtggcaaggttttgaaattgcctcacaagaaaaaatgttagaaaaggtaaac
acaaaattcaatgccgatgacttgtcagaaattgctcaaataattactgaattaccctct
gataaaggattcatcaataaaatcaagaaaattatatctgacagaaaagacggattcttc
aacaaccatatcgtagattggggaatggctgaacatttggcttttgctacgctactcacc
gaaggctttgatgtaagattgactgggcaagatgtacagcggggtactttttcacaccgc
cacgctgttgttaaatcggaagatttggaagaagaagtggtaatgcttcatcaacttaaa
aacaaagaaaaattttcaaaaggaaatttttacgtctataactctttgctgtctgaatat
ggggttttaggttttgaatacggatacgctttagcaagtcctaacacattaaccatttgg
gaagctcaatttggtgatttttcaaacggagctcaaattatgattgaccaatacgtttgc
tgcggagaagacaaatggaaaaatcaaaatggcgtggtactattactacctcacggctat
gaggggcaaggttcagagcactcctcggcacgtattgagcgttatttgcaactttgtgca
aacaaaaatatgtatgttgccaattgtactactcctgccaatattttccacttgttacgc
cgacaaatgaaaacggatttccgcaaacctttagtcgttttctctccgaagagcttgctc
cgccacccagaagtagtgtctcctataaatgacttagccaatgggcaatttcaagaggtt
attgatgaccccaacattgaccccaaaaaggttaaaactctagtgttctgctctggaaaa
ttctattatgatcttaaagctgaaagagagaaattaggtagagatgatgtagccttgata
cgtattgagcaattattccctttgccaacccaacaaatcaaagctgttattgctaaatac
aaaaaagcgaacgactacgtatgggcgcaagaagaacctaaaaatatgggagcttacggc
tatatgctgatgtattttgattggataaaatggcggttggcttgtgttagagccgcttcc
gctcctgcaccaggaagctacacccgtgacagaaaataccaccaacaagccatcaatgca
gtttttgattctaatatcgaccatcgcaaaaactaa

DBGET integrated database retrieval system