KEGG   Capnocytophaga canimorsus: Ccan_10960Help
Entry
Ccan_10960        CDS       T01582                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ccm  Capnocytophaga canimorsus
Pathway
ccm00620  Pyruvate metabolism
ccm00680  Methane metabolism
ccm01100  Metabolic pathways
ccm01120  Microbial metabolism in diverse environments
ccm01200  Carbon metabolism
Module
ccm_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ccm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ccan_10960
  09102 Energy metabolism
   00680 Methane metabolism
    Ccan_10960
Enzymes [BR:ccm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Ccan_10960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AEK23212
UniProt: F9YVP8
LinkDB All DBs
Position
complement(1166130..1168691)
Genome map
AA seq 853 aa AA seqDB search
MVRKTKLERFQEEVLNKYQIYNSIFMTLPFDEVSNTGTLLPLFSEACKNGYDEGLTPFQI
VNNFIARYVEHPTEKEKNDLLFRFIQYIERQVVLFDAIEDAAFSQVNNMEGLGTLRNAKE
QAENQEKEAALRNYLQHTKIRPVLTAHPTQFYPGAVLGIITDLSQAIQKNDLGLIKKLLA
QLGKTAFFKKEKPSPYDEAVSLIWYLENVFYHSVSNIYNYIFHNIFKNKPLENEIIQLGF
WPGGDRDGNPFVTAEITLKVAERLKRTVLKNYYRDIRNIKRRITFQGIQPLVEDLEIKLY
EISHLNKDESISLSELKQTLQQIKQLLVEKHQSLFVELIDDLLHKVNIFGFHFATLDIRQ
DSRVHHCVMNDIAESLAGKILPQNYDSLSISERLNALNTAQGILNPNDFSDEITKQTIES
VYAVKRIQLHNGEKGANRYIISNNQTALNVLELLTLIRLCDWEFPDIDIIPLFETINDLN
VAAQVMEELYTNPYYKAHLERRNNIQTIMLGFSDGTKDGGYLKANWSIYQAKEQLTTVAR
NNGIKVIFFDGRGGPPARGGGKSHQFYASLGDAIEAEQIQLTIQGQTISSNFGTIESSQY
NLEQLLSAGIDNQVFDDKSTLLTLADKALISQLAEESYKAYTDFKNHPLFVPYLEKMSTL
KYYAKANIGSRPSKRGKSEQLNFSDLRAIPFVGSWSQMKQNVPGFYGVGTALKHLEEIGK
FEEAKQLYKSSLFFRTLLENSMMSMTKSFFKLTEYIREDAEFGEFWQIIFDEYELSKQML
LKITGYKELMENQSCGKASIEIRETIVLPLLTIQQYALKMIRDNANTQENVEVYEKMVTR
SLFGNINASRNSA
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atggtaagaaagaccaaattagaacgatttcaagaagaggtgttaaataagtatcagatt
tacaatagtatatttatgactttgccgtttgatgaagtttccaatacgggtacattatta
cctcttttcagtgaagcttgcaaaaatggctatgatgaaggcttgactccctttcaaatt
gtcaataatttcatagctcgatatgtagagcatcccacagaaaaagagaaaaacgatttg
ctctttagatttattcaatatattgagcgtcaagttgttctatttgatgctattgaagat
gctgctttttcacaggttaacaatatggaaggcttaggaacgctacgtaacgctaaggaa
caagctgaaaatcaggaaaaagaagctgctttacgaaactatttacaacataccaaaata
cgacctgttctcacggctcatcccacacaattctatcccggagccgttttaggcatcatt
acagacttatctcaagcgatacaaaaaaatgatttaggtttgataaagaagctgttagct
caactgggaaaaacggcattctttaaaaaggaaaaaccttcaccatatgacgaggctgtt
agtctcatttggtacttagaaaatgttttttatcattcggtaagcaacatttacaattat
atttttcataatatatttaaaaacaagccgttagaaaacgaaattatacaacttggcttt
tggcctggtggtgatcgtgatggcaatccgtttgtaactgccgagattacactaaaggtc
gctgaaagattaaaacgtacagtattaaaaaattattacagagatataagaaatatcaaa
agacgtatcacttttcaaggaattcaacctttagttgaggatttggaaattaagttatat
gaaatcagtcatttgaataaagatgaatccataagtctttccgaactaaaacaaacccta
caacaaatcaaacaacttttagttgagaaacatcaatcgttatttgttgaactcattgat
gacctattacacaaggtaaatattttcggttttcattttgcaacccttgatattcgccaa
gactcgcgtgtgcatcattgtgtaatgaacgatattgctgaaagtcttgcaggaaaaatt
ttgcctcaaaactatgatagcttgtcaatatcagaacgactaaacgcattaaatacagct
caagggattttaaatccgaacgatttttctgacgaaattacaaaacaaacgatagaatct
gtttacgctgtaaagcgcattcaattacacaatggtgaaaaaggagctaatcgatatatt
atcagtaataatcagacagcgttgaacgttttggaactacttacactcattcgtttatgt
gattgggagtttcctgatattgatataattccgctatttgaaaccatcaatgaccttaac
gttgctgctcaagtaatggaagagctttacaccaatccgtactataaagcacacttagaa
agacgtaataatatacaaaccattatgttaggtttttctgatggcacgaaagatggggga
tacttaaaggcgaattggagcatctatcaagctaaggaacagcttactacggtagcgcgt
aacaacggtatcaaagttatatttttcgatgggaggggaggaccacctgcacgaggagga
ggaaaatcccatcaattttatgcctctttgggcgatgctattgaggctgaacaaatacag
ttaactattcaaggacaaaccattagctctaatttcggaactattgaatcatcacaatat
aatttagaacagttactcagtgcaggtattgataatcaagtttttgacgataagagcact
ttattaactttagctgataaagctttgatttctcaattggctgaggagagttataaggct
tatacagactttaagaatcatccgttatttgtaccttatttggaaaaaatgagtaccttg
aagtattatgctaaagcaaacataggaagtcgtccaagcaaaagagggaaatcagaacaa
ttgaatttcagtgatttaagagcaatcccttttgtaggcagttggagccagatgaagcaa
aatgttcctggtttttatggtgttgggacggctttgaaacacttagaagaaataggaaaa
tttgaagaagctaaacaactttataaaagttctttatttttccgtactttattagaaaac
agtatgatgagtatgactaagtcgtttttcaaacttacagaatatatccgtgaagatgct
gaatttggtgaattttggcagattatttttgatgaatacgaactttcaaaacaaatgctt
ttaaaaataactggctataaagagcttatggaaaatcaatcgtgtggaaaagcatctatt
gaaattcgtgaaacgattgttttaccattgctaaccatacagcaatatgctttaaaaatg
attcgtgataacgcaaatacacaagaaaatgttgaagtttatgaaaaaatggtaactcgc
tcattattcggtaatatcaatgctagtcgtaattcagcttaa

DBGET integrated database retrieval system