KEGG   Capnocytophaga canimorsus: Ccan_13860Help
Entry
Ccan_13860        CDS       T01582                                 

Definition
(GenBank) D-Ala-D-Ala ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ccm  Capnocytophaga canimorsus
Pathway
ccm00473  D-Alanine metabolism
ccm00550  Peptidoglycan biosynthesis
ccm01100  Metabolic pathways
ccm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ccm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Ccan_13860
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ccan_13860
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Ccan_13860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ccm01011]
    Ccan_13860
Enzymes [BR:ccm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Ccan_13860
Peptidoglycan biosynthesis and degradation proteins [BR:ccm01011]
 Precursor biosynthesis
  Amino acid ligase
   Ccan_13860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_3 ATP-grasp ATP-grasp_4 RimK GARS_A PE-PPE
Motif
Other DBs
NCBI-ProteinID: AEK23502
UniProt: F9YQG3
LinkDB All DBs
Position
complement(1480565..1481542)
Genome map
AA seq 325 aa AA seqDB search
MKKKVAVVMGGYSGECEVSLRSGQLILNSLDENKYEIYEIHILSEGWFFIENGKRFLIDK
GDFSAQKDGNKITFDVIVNTIHGTPGEDGQLQAYWKLLHIPYTGCDFYQSALTFNKRDTL
SVLAKFGIAKAESIYASKKDILDKDEIIKKLGLPLFVKANRSGSSLGVSKVKSTEEFNQA
LKNAFEVDDEILIESFLDGREISVGVLRLNGKTTVMGHTEIISENDFFDYEAKYEGKSQE
ITPAPLCDTLREKIDEVTVKIYESLNMSGFSRIDYIIVGDIPYFIEINTNPGLSPQSIFP
QQVAHKGLKFSDLLDSEIELAFQRK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaagtagctgttgttatgggcggatattctggggaatgcgaggtgtcctta
cgaagtggtcagcttattttgaatagtttagatgagaataagtatgaaatctatgaaatt
catattctatcagaaggttggtttttcattgaaaacggaaaacgatttttgatagataaa
ggcgatttctctgctcaaaaagatggaaataaaataacctttgacgtcattgtaaatacc
atacacggcacccctggagaagacggacaactgcaagcctattggaaattgttgcacatt
ccttatacgggttgtgatttttatcaatcggcactgacctttaacaaacgtgatacactt
tccgtacttgccaaattcggtattgctaaagcagagtcaatatatgcctcaaaaaaagat
attttagataaagatgaaattataaaaaaattaggactgcctttattcgttaaagcaaat
cgttctggaagtagtcttggagtttccaaggttaaaagtacagaggaatttaatcaagct
ttgaaaaatgcttttgaggtagatgatgaaattctaatagagtcatttcttgatggtaga
gaaatttctgtaggagtacttcgcttaaacggaaaaacaacggttatgggacatactgaa
attatttccgagaacgatttttttgattacgaagccaaatacgaaggaaaatctcaagaa
atcactccagcccccctttgcgatacacttcgtgagaaaatagatgaggttactgtaaaa
atttatgaatctttaaatatgagtggtttttcacgcattgattacattatagtgggagat
attccttattttatagaaatcaatactaatccagggctttctcctcaaagtatatttcca
cagcaagtggctcataaagggttgaaattttcggatttattggattccgaaattgaactt
gcttttcaacgaaaatag

DBGET integrated database retrieval system